Recombinant Xenopus tropicalis FERM domain-containing protein 3 (frmd3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
frmd3; FERM domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-600
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
frmd3
Target Protein Sequence
MFGCQCPRKKKGTMTMMRLRTASLRSLNLDMRCTIRLLDDTEISFNIQRDTKGQFLLDYI CNHYNLLEKDYFGIRFVDPEKQRHWLDPSKPVAKQMKSHPPYTMCFRVKFYPHEPLKIKE ELTRYLLYLQIKRDIFHGRLLCCFADAAFLGACIVQAEIGDYDPDEHPDNYICDFKIFPK QSQKLERKIVEIHKNELRGQSPSVSEFNLLLKAHSLETYGVDPHPCKDSTGTTTFLGYTA AGFVVFQGNKRIHLIKWPDICKMKFDGKTFHVVVMQKEKKNILTYHTSTPAACKHLWKCG VENQAFYKYAKSSQVKTVTSSNIFFKGSRFRYCGKVAKEVVEASSKIQRDPPEVHRSLIP HSRSSYSLNKQLIINMEPLQPLIPSPNEEEEEEEEENQIDEGILLLQQSEASSAPVLGNS PARGLETTADVTHDEEESIREEPLTISEQVYNPSASLLPTPVDEGIDMLFNSPLRAEREK DDTDSFEDLEADEHAFLIAEEEEMKEARKALSWSYNFIMGNMQLNAFLKSFSKLLLAAIG LLMVVLPLLLILLESDIDVSFLREIRLTPEFEQFHHEYYCPFRKWVACKLSAALNLFGST
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is Recombinant Xenopus tropicalis FERM domain-containing protein 3 (frmd3)?

Recombinant Xenopus tropicalis FERM domain-containing protein 3 (frmd3) is a full-length protein (amino acids 1-600) derived from the Western clawed frog (Silurana tropicalis). The protein is typically expressed in E. coli with an N-terminal His tag to facilitate purification and downstream applications. The recombinant protein maintains the complete amino acid sequence of the native protein and is available in lyophilized powder form for research applications . The protein contains the characteristic FERM domain, which typically mediates interactions between cytoplasmic proteins and the cytoskeleton, suggesting potential roles in cell adhesion, morphology, and membrane-cytoskeleton linkage. The recombinant form provides researchers with a reliable tool for investigating protein function, interactions, and structure-function relationships in controlled experimental settings.

How does Xenopus tropicalis frmd3 compare structurally to human FRMD3?

Xenopus tropicalis frmd3 and human FRMD3 share significant structural similarities while maintaining species-specific differences that may reflect evolutionary adaptations:

What are the optimal storage and reconstitution protocols for recombinant frmd3?

For maximum stability and activity of recombinant Xenopus tropicalis frmd3, the following storage and reconstitution protocols are recommended:

Storage Conditions:

  • Store the lyophilized protein at -20°C/-80°C upon receipt

  • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

  • Working aliquots may be stored at 4°C for up to one week only

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended default: 50%)

  • Prepare small aliquots for long-term storage at -20°C/-80°C

Buffer Composition:

  • The protein is supplied in a Tris/PBS-based buffer

  • Contains 6% Trehalose

  • Maintained at pH 8.0

It is critical to note that repeated freezing and thawing significantly reduces protein activity and should be strictly avoided. For experimental reproducibility, the reconstitution and storage protocols should be meticulously followed and documented in research protocols .

What are effective approaches for studying frmd3 protein-protein interactions?

Multiple complementary approaches can be employed to investigate frmd3 protein-protein interactions with varying degrees of sensitivity and physiological relevance:

In Vitro Binding Assays:

  • Pull-down Assays: Immobilize His-tagged recombinant frmd3 on Ni-NTA resin and incubate with cellular lysates to capture interacting partners

  • Surface Plasmon Resonance (SPR): Measure binding kinetics and affinities between frmd3 and potential partners in real-time

  • Isothermal Titration Calorimetry (ITC): Directly measure thermodynamic parameters of binding interactions

Cell-Based Interaction Studies:

  • Co-immunoprecipitation: Use anti-His antibodies to precipitate frmd3 complexes from cells expressing the recombinant protein

  • Proximity Labeling: Employ BioID or APEX2 fusion proteins to identify proteins in close proximity to frmd3 in living cells

  • Fluorescence Resonance Energy Transfer (FRET): Detect direct protein interactions in living cells through fluorescently tagged proteins

Validation and Characterization:

  • Domain Mapping: Create truncated versions of frmd3 to identify specific interaction domains

  • Mutagenesis: Introduce point mutations to disrupt specific binding interfaces

  • Competition Assays: Use synthetic peptides or competing proteins to validate binding specificity

When conducting these studies, it is essential to maintain protein stability by avoiding repeated freeze-thaw cycles and using the recommended storage buffer containing 6% trehalose and 50% glycerol for long-term storage . Additionally, proper controls, including non-specific proteins with similar tags, should be included to distinguish genuine interactions from experimental artifacts.

How can I use CRISPR/Cas9 to study frmd3 function in Xenopus tropicalis?

CRISPR/Cas9-mediated gene editing in Xenopus tropicalis provides a powerful approach to study frmd3 function through targeted mutations:

Guide RNA Design and Preparation:

  • Design sgRNAs targeting early exons of frmd3 to maximize the likelihood of functional disruption

  • Utilize tools like CHOPCHOP or CRISPRscan to identify target sequences with minimal off-target effects

  • Synthesize sgRNAs through in vitro transcription or order commercially

Microinjection Protocol:

  • Prepare ribonucleoprotein complexes by combining Cas9 protein with sgRNA(s)

  • Collect freshly fertilized X. tropicalis embryos

  • Inject 2-5 nl of the ribonucleoprotein complex into one-cell stage embryos

  • Culture injected embryos in appropriate medium at 25°C

Mutation Verification:

  • Extract genomic DNA from individual embryos or tadpoles

  • Amplify the targeted region using PCR

  • Analyze mutations through T7 endonuclease assay, heteroduplex mobility assay, or direct sequencing

  • Quantify mutation efficiency and characterize specific indel patterns

Phenotypic Analysis:

  • Monitor embryonic development at regular intervals

  • Document morphological abnormalities through imaging

  • Perform histological analyses of relevant tissues

  • Conduct behavioral assays for tadpoles (if neurological functions are implicated)

Xenopus tropicalis is particularly advantageous for CRISPR-based studies due to its diploid genome, rapid development, and the ability to generate thousands of embryos simultaneously . This allows for high-throughput screening of phenotypes and facilitates statistical analyses. Additionally, the high efficiency of CRISPR in Xenopus often permits analysis of F0 generation animals, accelerating the research timeline compared to other vertebrate models.

How can Xenopus tropicalis serve as a model organism for studying frmd3 function?

Xenopus tropicalis offers several significant advantages as a model organism for investigating frmd3 function:

Genetic and Genomic Advantages:

  • Diploid genome with high conservation between frogs and humans, making orthologous gene identification straightforward

  • High level of synteny with the human genome, facilitating comparative genomic analyses

  • Well-annotated reference genome available through Xenbase (https://www.xenbase.org)

  • Amenable to genetic manipulation through CRISPR/Cas9 and other techniques

Experimental Advantages:

  • Cost-effective maintenance compared to rodent colonies

  • Ability to produce 4000+ embryos per day through natural mating or in vitro fertilization

  • External development allows for easy observation and manipulation

  • Rapid development of organ systems within 4 days

  • Observable quantitative behaviors within 10 days for functional assessment

Translational Relevance:

  • Phenotypes often more closely recapitulate human conditions than rodent models

  • Ability to absorb small molecules from culture medium, facilitating drug screening

  • Studies of human disease genes in Xenopus have produced phenotypes that closely mirror human conditions

These characteristics make Xenopus tropicalis particularly suitable for high-throughput studies involving genetic manipulations to understand frmd3 function in development, tissue homeostasis, and disease contexts . The model allows for rapid generation of data that can inform more targeted studies in mammalian systems.

What approaches can be used to study frmd3 expression patterns in Xenopus tropicalis?

Multiple complementary techniques can be employed to characterize frmd3 expression patterns in Xenopus tropicalis, each with specific advantages:

Tissue-level Expression Analysis:

  • Whole-mount In Situ Hybridization (WISH): Visualize spatial expression patterns throughout development using RNA probes complementary to frmd3 mRNA

  • RT-PCR/qPCR: Quantify expression levels across tissues and developmental stages

  • Northern Blotting: Detect frmd3 transcript size and abundance in different tissues

Protein Localization:

  • Immunohistochemistry/Immunofluorescence: Visualize protein localization in tissue sections using antibodies against frmd3 or its epitope tag

  • Western Blotting: Detect protein expression levels across tissues and developmental stages

  • Tissue Clearing and 3D Imaging: Obtain comprehensive whole-organism protein localization data

Single-cell Resolution Approaches:

  • Single-cell RNA Sequencing (scRNA-seq): Characterize cell type-specific expression patterns

  • Spatial Transcriptomics: Map expression patterns with spatial resolution

  • Fluorescent Reporter Constructs: Generate transgenic animals expressing fluorescent proteins under the frmd3 promoter

When designing expression studies, it is important to consider temporal dynamics by sampling multiple developmental stages. Existing Xenopus tropicalis transcriptomic atlases can be screened for frmd3 expression to guide more targeted analyses . For protein localization studies, the commercially available recombinant His-tagged frmd3 can serve as a positive control for antibody validation .

The combination of these approaches provides a comprehensive understanding of where and when frmd3 is expressed, offering insights into its potential functions during development and in adult tissues.

How can I design functional rescue experiments for frmd3 in Xenopus tropicalis?

Functional rescue experiments are crucial for confirming the specificity of phenotypes observed following frmd3 disruption and for testing the functional equivalence of different protein variants. Here is a methodological approach for designing rigorous rescue experiments:

Knockdown/Knockout Strategies:

  • Generate frmd3-deficient embryos through CRISPR/Cas9-mediated mutagenesis

  • Alternatively, use morpholino oligonucleotides for temporary knockdown

  • Characterize the resulting phenotypes comprehensively

Rescue Construct Design:

  • Wild-type Rescue: Clone the full-length wild-type frmd3 coding sequence into an expression vector

  • Domain-specific Rescues: Generate constructs expressing specific domains to map functional regions

  • Species Comparison: Create constructs expressing human FRMD3 to test cross-species functional conservation

  • Variant Testing: Introduce specific mutations to test the impact of natural variants or disease-associated mutations

Experimental Design:

  • Co-inject rescue mRNA along with CRISPR components or morpholinos

  • Include appropriate controls:

    • Uninjected embryos (negative control)

    • CRISPR/morpholino-only embryos (phenotype control)

    • Injection of an unrelated mRNA (specificity control)

  • Test multiple doses of rescue mRNA to establish dose-response relationships

  • Examine both morphological and molecular phenotypes

Quantitative Assessment:

  • Score phenotypes blindly using predefined criteria

  • Calculate rescue efficiency as the percentage of embryos showing phenotypic restoration

  • Apply appropriate statistical tests to determine significance

  • Document partial rescues and dose-dependent effects

When preparing rescue constructs, ensure that they are resistant to the knockdown strategy used (e.g., containing silent mutations that prevent CRISPR targeting or morpholino binding). For recombinant protein expression, the commercially available constructs containing the full-length Xenopus tropicalis frmd3 (1-600aa) can serve as templates .

How can comparative studies between Xenopus tropicalis frmd3 and human FRMD3 inform disease mechanisms?

Comparative studies between Xenopus tropicalis frmd3 and human FRMD3 provide valuable insights into conserved functions and potential disease mechanisms through multiple experimental approaches:

Sequence-Structure-Function Analysis:

  • Align Xenopus tropicalis frmd3 (1-600aa) and human FRMD3 (1-597aa) sequences to identify conserved domains and motifs

  • Generate structural models to predict functional surfaces and binding interfaces

  • Compare predicted post-translational modification sites that might regulate protein function

Cross-Species Functional Conservation:

  • Rescue Experiments: Test whether human FRMD3 can functionally replace Xenopus frmd3 in knockout tadpoles

  • Domain Swapping: Create chimeric proteins to identify regions responsible for species-specific functions

  • Protein Interaction Networks: Compare binding partners between species to identify conserved molecular pathways

Disease Variant Modeling:

  • Introduce human disease-associated FRMD3 variants into the equivalent positions in Xenopus frmd3

  • Characterize resulting phenotypes at morphological, cellular, and molecular levels

  • Test potential therapeutic interventions by exploiting the ability of tadpoles to absorb compounds from culture medium

This comparative approach has particular value because Xenopus disease models often recapitulate human phenotypes more closely than rodent models. For example, mutations in the essential eye transcription factor gene pax6 in Xenopus result in a phenotype very similar to human congenital aniridia, while mouse mutations produce a different "small-eye" phenotype . This suggests that frmd3 studies in Xenopus might similarly provide relevant insights into human FRMD3-related functions or disorders.

What strategies can be employed for high-throughput phenotypic screening of frmd3 variants?

Xenopus tropicalis provides an excellent platform for high-throughput phenotypic screening of frmd3 variants due to its rapid development, external fertilization, and large clutch sizes. The following methodological approach outlines strategies for efficient screening:

Variant Library Generation:

  • Disease-associated Variants: Compile known human FRMD3 variants from clinical databases

  • Structure-guided Variants: Design mutations targeting key functional residues based on structural predictions

  • Domain-specific Variants: Create systematic mutations across different protein domains

  • Conservation-based Approach: Prioritize highly conserved residues across species

High-efficiency Mutagenesis:

  • CRISPR Base Editing: Utilize cytosine or adenine base editors for precise nucleotide substitutions

  • Homology-Directed Repair: Co-inject CRISPR components with repair templates containing desired variants

  • mRNA Overexpression: Inject variant mRNAs into wild-type or frmd3-knockout backgrounds

Automated Phenotyping Platforms:

  • High-content Imaging: Employ automated microscopy systems for morphological analysis

  • Behavior Tracking: Use computer vision systems to quantify swimming patterns and responses

  • Reporter Assays: Develop fluorescent reporters for pathway activation or cellular processes

Analysis Pipeline:

  • Design standardized phenotyping protocols with clearly defined metrics

  • Implement machine learning algorithms for automated phenotype classification

  • Establish statistical thresholds for significant phenotypic changes

  • Create a database linking variant characteristics to phenotypic outcomes

This approach capitalizes on the unique advantages of Xenopus tropicalis, which allows the generation of thousands of embryos in a single day and permits the analysis of F0 generation animals due to the high efficiency of CRISPR editing . The ability to perform parallel testing of multiple variants accelerates the identification of functionally significant residues and provides insights into structure-function relationships that may be relevant to human disease.

How can multi-omics approaches enhance our understanding of frmd3 function in Xenopus tropicalis?

Integrating multiple omics technologies provides a comprehensive systems-level understanding of frmd3 function in Xenopus tropicalis. This methodological framework outlines how to implement and integrate various omics approaches:

Genomics and Epigenomics:

  • ChIP-seq: Identify genomic regions associated with frmd3-interacting transcription factors

  • ATAC-seq: Profile chromatin accessibility changes in frmd3-deficient embryos

  • Cut&Run/Cut&Tag: Map precise binding sites of frmd3-associated chromatin factors

Transcriptomics:

  • Bulk RNA-seq: Characterize gene expression changes in frmd3 mutants across developmental stages

  • Single-cell RNA-seq: Identify cell type-specific responses to frmd3 disruption

  • Spatial Transcriptomics: Map expression changes with spatial resolution in intact embryos

Proteomics:

  • Affinity Purification-Mass Spectrometry (AP-MS): Identify frmd3 protein interaction networks

  • Proximity Labeling: Characterize the local protein environment of frmd3 in living cells

  • Phosphoproteomics: Profile signaling pathway alterations in frmd3-deficient contexts

Metabolomics:

  • Analyze metabolic changes in frmd3 mutants to identify affected pathways

  • Profile lipid composition alterations, particularly in membrane fractions

Integrative Analysis Framework:

  • Employ network analysis to integrate multi-omics datasets

  • Identify molecular pathways and processes affected by frmd3 perturbation

  • Validate key nodes in the network through targeted experiments

  • Develop predictive models of frmd3 function

The implementation of these approaches in Xenopus tropicalis is particularly advantageous due to the ability to generate large numbers of synchronously developing embryos, facilitating statistical power in omics analyses . Additionally, the rapid development and external fertilization allow for precise staging and temporal resolution of molecular changes following frmd3 perturbation. The resulting integrated datasets provide a comprehensive view of frmd3 function across molecular scales, revealing both direct effects and downstream consequences of frmd3 disruption.

What quality control measures should be implemented when working with recombinant frmd3?

Rigorous quality control is essential for ensuring reproducible results when working with recombinant Xenopus tropicalis frmd3. The following methodological framework outlines critical quality control measures:

Protein Integrity Assessment:

  • SDS-PAGE Analysis: Verify protein size and purity (should be >90% as specified by manufacturers)

  • Western Blotting: Confirm protein identity using anti-His tag antibodies or specific anti-frmd3 antibodies

  • Mass Spectrometry: Validate protein identity and detect potential post-translational modifications or degradation products

Functional Validation:

  • Binding Assays: Test interaction with known binding partners to confirm functional activity

  • Thermal Shift Assays: Assess protein stability under experimental conditions

  • Circular Dichroism: Verify proper secondary structure formation

Storage and Handling Verification:

  • Implement lot tracking and record storage conditions for each aliquot

  • Document freeze-thaw cycles and maintain single-use aliquots when possible

  • Verify pH and buffer composition before experimental use

Batch Consistency Testing:

  • Compare protein activity between different production lots

  • Maintain reference standards for batch-to-batch comparisons

  • Implement standardized activity assays specific to frmd3 function

For optimal results, reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL and add glycerol to a final concentration of 5-50% for long-term storage at -20°C/-80°C . Avoid repeated freeze-thaw cycles by preparing single-use aliquots, and store working aliquots at 4°C for no more than one week. These precautions help maintain protein integrity and functional activity, ensuring experimental reproducibility.

What considerations are important when designing antibodies against Xenopus tropicalis frmd3?

Designing effective antibodies against Xenopus tropicalis frmd3 requires careful consideration of multiple factors to ensure specificity, sensitivity, and experimental utility:

Epitope Selection Strategies:

  • Sequence Analysis:

    • Identify regions unique to frmd3 (avoid conserved FERM domains if specificity between family members is required)

    • Select regions with high antigenicity using prediction algorithms

    • Compare with human FRMD3 sequence if cross-reactivity is desired

  • Structural Considerations:

    • Target surface-exposed regions based on structural predictions

    • Avoid transmembrane or buried regions that may be inaccessible

    • Consider the native protein conformation in the cellular context

  • Application-specific Approaches:

    • For Western blotting: linear epitopes often perform well

    • For immunoprecipitation: conformational epitopes may be preferable

    • For immunohistochemistry: fixation-resistant epitopes are essential

Antibody Production Methods:

  • Peptide Antibodies:

    • Design synthetic peptides (15-25 amino acids) from selected regions

    • Couple to carrier proteins for immunization

    • Consider multiple peptides targeting different regions

  • Recombinant Protein Immunization:

    • Use available recombinant His-tagged frmd3 (1-600aa) as immunogen

    • Consider domain-specific constructs for targeted antibodies

  • Genetic Immunization:

    • Employ DNA vaccination approaches for complex antigens

Validation Requirements:

  • Specificity Testing:

    • Test against recombinant protein

    • Verify recognition of endogenous protein in Xenopus tissues

    • Demonstrate absence of signal in frmd3 knockout/knockdown samples

    • Test cross-reactivity with other FERM domain proteins

  • Application Validation:

    • Validate separately for each intended application (WB, IP, IHC, etc.)

    • Optimize conditions for each experimental context

    • Determine detection limits and dynamic range

When using the commercially available recombinant frmd3 as a reference or control, maintain proper storage and handling practices as specified in product documentation (storage at -20°C/-80°C, minimizing freeze-thaw cycles) . For antibody validation, consider the high conservation between Xenopus and human FRMD3 sequences when evaluating potential cross-reactivity with human samples.

What are the critical parameters for successful expression and purification of functional frmd3?

The expression and purification of functional Xenopus tropicalis frmd3 requires optimization of multiple parameters to ensure high yield, purity, and biological activity:

Expression System Selection:

  • Prokaryotic Systems (E. coli):

    • Advantages: High yield, cost-effective, established protocols

    • Challenges: Potential folding issues, lack of post-translational modifications

    • Optimization: Test multiple strains (BL21, Rosetta, etc.), consider fusion partners (MBP, SUMO)

  • Eukaryotic Systems:

    • Insect cells: Better folding of complex proteins

    • Mammalian cells: Appropriate post-translational modifications

    • Selection criteria: Required authenticity vs. yield considerations

Expression Conditions Optimization:

  • Temperature: Lower temperatures (16-25°C) often improve folding

  • Induction Parameters: IPTG concentration, induction duration

  • Media Composition: Rich vs. minimal media, supplementation strategies

  • Co-expression Strategies: Chaperones, folding assistants

Purification Strategy Development:

  • Initial Capture:

    • Immobilized metal affinity chromatography (IMAC) for His-tagged frmd3

    • Optimize binding and elution conditions (imidazole concentration, pH)

  • Additional Purification Steps:

    • Size exclusion chromatography to remove aggregates

    • Ion exchange chromatography for charge variant separation

    • Affinity chromatography for specific binding partners

  • Quality Assessment:

    • SDS-PAGE for purity (target >90%)

    • Western blotting for identity confirmation

    • Dynamic light scattering for aggregation analysis

Stability Enhancement:

  • Buffer Optimization:

    • Test various pH conditions (typically 7.0-8.0)

    • Evaluate different salt concentrations

    • Consider stabilizing additives (glycerol, trehalose)

  • Storage Formulation:

    • Lyophilization in Tris/PBS-based buffer with 6% trehalose at pH 8.0

    • Addition of 5-50% glycerol for frozen storage

    • Aliquoting to prevent freeze-thaw cycles

The commercially available recombinant Xenopus tropicalis frmd3 is expressed in E. coli with an N-terminal His tag and purified to >90% purity as determined by SDS-PAGE . For researchers expressing their own recombinant protein, these specifications can serve as a quality benchmark. The protein is provided in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which has been optimized for stability and functionality.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.