Recombinant Xenopus tropicalis Frizzled-7 (fzd7)

Shipped with Ice Packs
In Stock

Description

Molecular Structure and Production

Recombinant Xenopus tropicalis Fzd7 is engineered with a His-tag for purification and detection purposes. Key structural and production details include:

PropertyDetails
UniProt IDQ5BL72
Amino Acid Sequence548 residues (mature protein: aa 20–548)
Domains- N-terminal cysteine-rich domain (CRD) for ligand binding
- Seven transmembrane helices
Expression SystemEscherichia coli (E. coli)
Storage-20°C (short-term); -80°C (long-term) in Tris-based buffer with 50% glycerol

Biological Functions in Xenopus tropicalis

Fzd7 mediates both canonical (β-catenin-dependent) and non-canonical Wnt signaling pathways:

Role in Gastrulation

  • Regulates convergent extension movements during embryogenesis by interacting with Xwnt11 and Dishevelled (Dvl) .

  • Overexpression disrupts mesodermal involution, while truncated forms (e.g., extra-Xfz7) partially rescue these defects .

  • Signals via Cdc42 GTPase to modulate actin cytoskeleton dynamics .

Cardiogenesis

  • Expressed in the primary heart field during Xenopus development .

  • Knockdown via morpholinos causes heart malformations, while dominant-negative Fzd7 CRD induces cardia bifida .

Key Studies

Study FocusFindingsSource
Wnt/β-catenin signalingChimeric receptors revealed extracellular domain binds Xwnt-5a, while intracellular domains transmit β-catenin signals .
Planar Cell PolaritySynergizes with Xwnt11 to activate non-canonical pathways via Cdc42 .
Protein InteractionsBinds Wnt ligands (e.g., Xwnt-8b, Xwnt-5a) and synergizes with Dishevelled .

Experimental Models

  • Activin-treated animal caps: Used to demonstrate Fzd7’s role in Wnt11-mediated convergent extension .

  • Morpholino knockdown: Confirmed Fzd7’s necessity for normal heart tube formation .

Evolutionary and Functional Conservation

Fzd7 homologs across species share structural and functional similarities:

  • Human FZD7: Regulates β-catenin signaling in cancers .

  • Mouse Fzd7: Essential for embryonic development and tissue polarity .

Challenges and Future Directions

  • Ligand Specificity: Further studies needed to map precise Wnt-Fzd7 interactions .

  • Therapeutic Potential: Targeting Fzd7 in Wnt-driven cancers remains exploratory .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have any specific format requirements, please indicate them in your order notes, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
fzd7; TNeu065e03.1; Frizzled-7; Frz7; Fz-7
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
20-548
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
Target Protein Sequence
QQYHGEKGISVPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKV QCSPELRFFLCSMYAPVCTVLEQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFP VHGAGEICVGQNTSDNSPSGPTARPTPYLPDSITFHPHPNRDFTCPRQLKVPPYLGYRFL GEKDCGAPCEPGKANGLMYFKEEEVRFARLWVGIWAILCGISTLFTVLTYLVDMRRFSYP ERPIIFLSGCYFMVAVAYTAGFLLEERGVCVERFSEDSYRTVAQGTKKEGCTILFMILYF FGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGD ILSGVCYVGINSVDSLRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLE KLMVRIGVFSVMYTVPATIVLACYFYEQAFRDTWEKTWLVQTCKGFAVPCPNYNFAPMSP DFTVFMIKYLMTMIVGITSSFWIWSGKTLQSWRRFYHRLSNGGKGETAV
Uniprot No.

Target Background

Function
Frizzled-7 (Fzd7) is a receptor for Wnt proteins. It plays a role in both canonical and non-canonical Wnt signaling pathways. While research suggests varying Wnt protein preferences, Wnt5a, Wnt8b, and Wnt11 have been proposed as potential synergists. In the canonical Wnt pathway, Fzd7 interacts with β-catenin to promote the expression of dorsal genes such as siamois, twin, and nodal3, ultimately establishing the dorsal axis of the embryo and inducing dorsal mesoderm formation. In the non-canonical Wnt/planar cell polarity (PCP) pathway, Fzd7 collaborates with sdc4 and dvl2/dsh to regulate convergent extension movements during gastrulation. This interaction triggers phosphorylation of dvl2/dsh and its translocation to the plasma membrane. In a third, non-canonical Wnt signaling branch, Fzd7 acts independently of dvl2/dsh via trimeric G proteins to recruit protein kinase C (PKC) to the membrane, thereby activating PKC signaling. This PKC signaling is involved in cell sorting and tissue separation during gastrulation.
Database Links
Protein Families
G-protein coupled receptor Fz/Smo family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Xenopus tropicalis Frizzled-7 (fzd7) and how is it characterized?

Recombinant Xenopus tropicalis Frizzled-7 (fzd7) is a transmembrane protein receptor expressed in the Western clawed frog (Silurana tropicalis). It is typically produced using in vitro E. coli expression systems and is available as a full-length mature protein with an N-terminal 10xHis-tag. The protein corresponds to the expression region 20-548 of the complete sequence and contains the characteristic frizzled domains. The recommended nomenclature includes Frizzled-7, Frz7, or Fz-7 as acceptable short names. Proper characterization involves confirming the correct amino acid sequence and protein folding using techniques such as western blotting and functional assays to verify its ability to interact with appropriate ligands .

The recombinant protein contains multiple distinct domains, including the extracellular cysteine-rich domain (CRD) that binds Wnt ligands, a seven-transmembrane domain, and an intracellular domain that interacts with downstream effectors like Dishevelled. Researchers should verify domain integrity when using commercially available preparations to ensure proper experimental outcomes .

What signaling pathways does Frizzled-7 participate in during Xenopus development?

Xenopus Frizzled-7 (Xfz7) participates in both canonical and non-canonical Wnt signaling pathways during development. In the canonical pathway (Wnt-1-type), Xfz7 signals through Dishevelled (Dsh) to ultimately regulate β-catenin-dependent gene transcription of targets such as siamois and nodal related 3 (Xnr-3). This pathway is critical for early dorsal axis formation and cell fate specification .

In the non-canonical pathway, Xfz7 signals through mechanisms involving protein kinase C (PKC) activation, independent of β-catenin. This pathway primarily regulates cell polarity and morphogenetic movements during gastrulation. Specifically, Xfz7 biochemically and functionally interacts with Xwnt11 to control convergent extension movements. Interestingly, both gain-of-function and loss-of-function of Xfz7 produce similar phenotypes related to convergent extension defects, suggesting a precise level of signaling is required for proper development .

How is Frizzled-7 expressed during Xenopus development?

Frizzled-7 exhibits a dynamic expression pattern during Xenopus development. Low levels of maternal Xfz7 transcripts are present during early cleavage stages, followed by a significant increase in zygotic expression at the onset of gastrulation. The expression is predominantly localized to two key regions: the presumptive neuroectoderm and the deep cells of the involuting mesoderm .

This spatiotemporal expression pattern correlates with its functional roles in both neuroectoderm and mesoderm development. Interestingly, frizzled-7 expression is regulated by Wnt signaling itself, creating a positive feedback loop. This Wnt-dependent expression of its own receptor appears essential for establishing proper signaling gradients during development. The expression pattern can be visualized using in situ hybridization techniques, which reveal the dynamic changes in different germ layers throughout early development .

What is the role of Frizzled-7 in convergent extension during gastrulation?

Frizzled-7 plays a critical role in regulating convergent extension movements during Xenopus gastrulation. Convergent extension is a process where cells intercalate to narrow and elongate tissue along one axis. Overexpression of Xfz7 in the dorsal equatorial region disrupts these movements and delays mesodermal involution, altering the correct localization (but not expression) of mesodermal and neural markers .

Mechanistically, Xfz7 interacts with Xwnt11 to regulate convergent extension, and this interaction involves Dishevelled but not β-catenin. This indicates that Xfz7 controls convergent extension through non-canonical Wnt signaling. The small GTPase Cdc42, a key regulator of the actin cytoskeleton, acts downstream of Xfz7 in this process. Overexpression of Xfz7 and Xwnt11 disrupts convergent extension in activin-treated animal caps, which can be rescued by co-expression of dominant-negative Cdc42(T17N), while constitutively active Cdc42(G12V) can rescue the effects of truncated Xfz7 in a dose-dependent manner .

How does the positive feedback regulation of Frizzled-7 expression contribute to Wnt gradient formation?

The positive feedback regulation of Frizzled-7 expression is a sophisticated mechanism that shapes steep Wnt signaling gradients during development. Research has demonstrated that frizzled-7 is expressed in a Wnt-dependent manner, creating a feedback loop that amplifies Wnt signaling in responding cells. Through combined experimental approaches and mathematical modeling, this receptor feedback has been shown to be essential for establishing the precise spatial gradient of Wnt activity required for proper tissue patterning, particularly in thin tissues like the pericardium .

Mathematical simulations reveal that this feedback mechanism provides two critical advantages: (1) it imparts robustness against variations in Wnt ligand production, preventing developmental errors that might arise from fluctuations in morphogen levels, and (2) it allows the signaling system to reach steady state quickly, which is essential for the rapid developmental processes occurring during embryogenesis. This elegant regulatory circuit ensures that Wnt signaling gradients are reproducibly established despite potential variability in the initial conditions of morphogen production .

What experimental approaches can be used to study Frizzled-7 recruitment of Dishevelled to the plasma membrane?

Studying Frizzled-7 recruitment of Dishevelled to the plasma membrane requires sophisticated experimental approaches. One effective method involves overexpressing Xfz7 and analyzing its effect on the subcellular distribution of tagged Dishevelled protein (Xdsh-myc). Immunofluorescence microscopy can be used to visualize the translocation of Xdsh-myc from its typical cytoplasmic distribution to the plasma membrane when co-expressed with Xfz7 .

Biochemical approaches, including co-immunoprecipitation assays, can confirm the physical interaction between Xfz7 and Xdsh. To assess the functional consequences of this recruitment, researchers can measure the activation of Wnt target genes such as siamois and nodal related 3 (Xnr-3) using RT-PCR or reporter gene assays. Interestingly, while Xfz7 can recruit Xdsh-myc to the plasma membrane, target genes of the Wnt-1-type pathway are only activated in the presence of exogenous Xdsh-myc. This suggests that the endogenous Xdsh pool and exogenous Xdsh-myc differ in their ability to be recruited by Frizzled receptors or to activate downstream signaling .

How do gain-of-function and loss-of-function of Frizzled-7 affect convergent extension during gastrulation?

A fascinating aspect of Frizzled-7 signaling is that both gain-of-function and loss-of-function approaches produce similar phenotypes affecting convergent extension during gastrulation. Overexpression of wild-type Xfz7 in the dorsal equatorial region disrupts convergent extension movements and delays mesodermal involution. This phenotype can be rescued by extra-Xfz7, a secreted form of the receptor lacking the transmembrane domains .

Notably, the secreted form also weakly inhibits convergent extension when overexpressed alone, suggesting it functions as a dominant-negative. This indicates that precise levels of Xfz7 signaling are required for proper morphogenetic movements. The mechanism likely involves proper regulation of the actin cytoskeleton through Cdc42, as constitutively active Cdc42(G12V) rescues the effects of extra-Xfz7 on convergent extension in a dose-dependent manner. This phenotypic similarity between gain and loss of function is reminiscent of the well-documented phenomenon in Drosophila tissue polarity, suggesting evolutionary conservation of this signaling principle .

What are the optimal storage and handling conditions for recombinant Frizzled-7 protein to maintain functionality?

Maintaining the functionality of recombinant Frizzled-7 protein requires adherence to specific storage and handling protocols. The recommended storage temperature is -20°C, with extended storage preferably at -20°C or -80°C to preserve protein integrity. Repeated freezing and thawing significantly compromises protein quality and should be strictly avoided. For ongoing experiments, working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw cycles .

The shelf life of recombinant Frizzled-7 varies depending on formulation: liquid preparations typically maintain stability for approximately 6 months at -20°C/-80°C, while lyophilized forms remain stable for up to 12 months under the same conditions. Several factors influence shelf life, including buffer composition, storage temperature, and the intrinsic stability of the protein itself. Researchers should verify protein activity after extended storage periods using functional assays that assess the ability of the recombinant protein to bind Wnt ligands or activate downstream signaling pathways .

How does heparan sulfate modification influence the interaction between Frizzled-7 and Wnt antagonists?

Heparan sulfate (HS) modification plays a critical role in regulating the interaction between Frizzled-7 and Wnt antagonists like secreted Frizzled-related protein 1 (sFRP1). Research in Xenopus has demonstrated that sFRP1, which is expressed on the opposite side of the Wnt source, accumulates specifically on N-acetyl-rich heparan sulfate. The concentration of N-acetyl-rich HS is particularly high in the region between the sources of Wnt and sFRP1 .

This strategic localization of modified HS achieves local inhibition of Wnt signaling through restriction of sFRP1 spreading. The mechanism creates a precise boundary for Wnt activity, which is essential for the accurate patterning of thin tissues like the pericardium. This integrated regulatory system, working in conjunction with the positive feedback regulation of Frizzled-7 expression, restricts the Wnt signaling range and ensures reproducible tissue patterning. The interaction between HS modifications and Wnt pathway components represents an elegant example of how the extracellular matrix contributes to the fine-tuning of morphogen gradients during development .

What expression systems are optimal for producing functional recombinant Xenopus tropicalis Frizzled-7?

The in vitro E. coli expression system has been successfully used to produce functional recombinant Xenopus tropicalis Frizzled-7. This system allows for the expression of the full-length mature protein (region 20-548) with an N-terminal 10xHis-tag for purification purposes. The resulting recombinant protein contains the complete functional domains necessary for Wnt binding and signal transduction .

When designing expression constructs, researchers should consider incorporating appropriate tags (such as His-tags or myc-tags) that facilitate purification while minimizing interference with protein function. For applications requiring mammalian glycosylation patterns, alternative expression systems such as HEK293 or CHO cells may be preferable, though these were not specifically mentioned in the provided research materials. Regardless of the expression system chosen, functional validation through binding assays and cell-based activity tests is essential to confirm that the recombinant protein maintains its native binding and signaling properties .

What methods can detect the interaction between Frizzled-7 and Wnt ligands in Xenopus developmental contexts?

Several complementary methods can be employed to detect interactions between Frizzled-7 and Wnt ligands during Xenopus development. Biochemical approaches include co-immunoprecipitation assays, where antibodies against either Frizzled-7 or Wnt ligands (such as Xwnt11 or Xwnt-8b) can be used to pull down protein complexes from embryo lysates, followed by western blot analysis to detect the binding partner. Surface plasmon resonance or ELISA-based binding assays using purified recombinant proteins can provide quantitative measurements of binding affinities .

Functional assays that assess downstream signaling activation provide indirect evidence of receptor-ligand interaction. These include RT-PCR or reporter gene assays measuring the expression of Wnt target genes like siamois and nodal related 3 (Xnr-3) after co-expression of Frizzled-7 with various Wnt ligands. In vivo visualization techniques, such as fluorescently tagged proteins combined with confocal microscopy, can track the co-localization of Frizzled-7 and Wnt ligands at the cell membrane. These approaches collectively provide comprehensive insights into the specificity and context-dependency of Frizzled-7-Wnt interactions during development .

How can researchers distinguish between canonical and non-canonical Wnt signaling downstream of Frizzled-7?

Distinguishing between canonical and non-canonical Wnt signaling downstream of Frizzled-7 requires multiple experimental approaches. For canonical Wnt signaling, researchers should assess β-catenin stabilization and nuclear localization using western blotting of nuclear fractions or immunofluorescence microscopy. Activation of target genes specific to canonical Wnt signaling, such as siamois and nodal related 3 (Xnr-3), can be measured by RT-PCR or reporter assays .

For non-canonical signaling, researchers should examine PKC activation, calcium flux using calcium-sensitive dyes, or JNK phosphorylation via western blotting. Morphological assays that assess convergent extension in animal caps or whole embryos provide functional readouts of non-canonical signaling. The involvement of specific mediators can be tested through co-expression experiments: Dishevelled participates in both pathways, but β-catenin is specific to canonical signaling. Similarly, small GTPases like Cdc42 are primarily involved in non-canonical pathways regulating cytoskeletal dynamics. Rescue experiments using pathway-specific components can further clarify which signaling branch is active in a particular context .

What are common challenges in interpreting Frizzled-7 overexpression phenotypes and how can they be addressed?

Interpreting Frizzled-7 overexpression phenotypes presents several challenges. A primary complication is that both gain-of-function and loss-of-function of Frizzled-7 can produce similar phenotypes, particularly in convergent extension movements. This paradoxical effect, also observed with Dishevelled in Drosophila tissue polarity, suggests that precise signaling levels are critical for proper function. To address this, researchers should implement graded overexpression experiments using inducible or dose-controlled expression systems to establish dose-response relationships .

Another challenge is distinguishing direct effects from secondary consequences of disrupted development. Careful staging and tissue-specific expression approaches can help isolate primary effects. Using complementary approaches, such as combining overexpression with targeted knockdown via morpholinos or dominant-negative constructs, can validate specificity. Additionally, researchers should employ rescue experiments with pathway components (like constitutively active Cdc42 to rescue convergent extension defects) to confirm the signaling mechanisms involved. Time-lapse imaging of cellular behaviors in manipulated tissues provides valuable insights into the direct cellular effects of Frizzled-7 modulation .

How can the positive feedback between Wnt signaling and Frizzled-7 expression be experimentally validated?

Validating the positive feedback between Wnt signaling and Frizzled-7 expression requires a multi-faceted experimental approach. The fundamental relationship can be established by treating Xenopus embryonic tissues or cells with recombinant Wnt proteins or Wnt pathway activators, followed by quantification of Frizzled-7 mRNA and protein levels using RT-qPCR and western blotting, respectively. Conversely, inhibiting Wnt signaling using antagonists like Dkk1 or dominant-negative Wnt constructs should reduce Frizzled-7 expression if the feedback loop is operative .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.