Recombinant Xenopus tropicalis Gap junction gamma-1 protein (gjc1)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of GJC1

GJC1, also known as connexin 45 (Cx45), is a transmembrane protein that facilitates the exchange of small molecules (≤1–1.5 kDa) between adjacent cells. Key features include:

PropertyDetails
Gene Namegjc1
OrganismXenopus tropicalis (Western clawed frog)
Uniprot IDQ6NZH5
Protein Length377 amino acids
Structural Domains4 transmembrane helices, intracellular N- and C-termini
Expression SystemRecombinant production in E. coli
Storage ConditionsTris-based buffer with 50% glycerol; store at -20°C or -80°C

The full-length protein includes conserved connexin motifs, such as extracellular loop cysteine residues critical for channel docking and intracellular regions regulating gating .

Recombinant Production and Purification

Recombinant GJC1 is engineered for high purity and stability, enabling functional studies:

  • Expression: Optimized in E. coli with tags (e.g., His-tag) for simplified purification .

  • Purity: ≥95% verified by SDS-PAGE and Coomassie staining .

  • Formulations: Lyophilized with cryoprotectants (trehalose/mannitol) for long-term stability .

Sequence Highlights:
The N-terminal region (1–50 aa) contains regulatory phosphorylation sites, while transmembrane domains (51–220 aa) mediate channel assembly .

Functional Roles in Cellular Communication

GJC1 forms hexameric connexons that dock with adjacent cells to create gap junctions. Key roles include:

  • Ion Homeostasis: Facilitates passive diffusion of ions (K⁺, Ca²⁺) .

  • Metabolite Exchange: Enables transfer of second messengers (cAMP, IP₃) .

  • Electrical Synapses: Critical in excitable tissues (e.g., cardiac muscle, neurons) .

Pathway Associations:

  • Gap junction trafficking

  • Cell cycle regulation (linked to glioma progression in human studies)

4.1. Basic Research

  • Xenopus Models: Used to study developmental biology due to conserved synteny with human genomes .

  • Channel Dynamics: Structural analyses of voltage gating and pH sensitivity .

4.2. Disease Relevance

While X. tropicalis GJC1 itself is not directly linked to human diseases, homologs like human GJC1 (Cx45) are implicated in:

  • Glioma Prognosis: Elevated GJC1 expression correlates with high-grade tumors and poor survival .

  • Cardiac Abnormalities: Altered connexin expression disrupts electrical coupling in arrhythmias .

Comparative Insights from Human Studies

Human GJC1 (Uniprot: P36383) shares 68% sequence identity with X. tropicalis GJC1. Key differences include:

FeatureX. tropicalis GJC1Human GJC1
Length377 aa396 aa
Glycosylation SitesNone2 predicted N-linked sites
Disease AssociationN/AGlioma, heart disease

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request if possible.
Lead Time
Delivery time may vary based on purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. This can serve as a reference for your preparation.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize development of the specified tag if feasible.
Synonyms
gjc1; gja7; Gap junction gamma-1 protein; Gap junction alpha-7 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-377
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
gjc1
Target Protein Sequence
MSWSFLTRLLEEINNHSTFVGKVWLTVLIIFRIVLTAVGGESIYYDEQSKFTCNTQQPGC ENVCYDAFAPLSHVRFWVFQIILITTPSIMYLGFAMHRIARQPEMQIRRSEKTKSKKRAP IIHRGAMRDYEEAEDNQEEDPMICEEEEPEKDSEKGDKKKHDGRRRIKQDGLMKVYVLQL LFRSVFEVGFLMGQYILYGFEVIPFFVCSRKPCPHTVDCFVSRPTEKTIFLLIMYAVSAL CLFLNLCELFHLGIGGIRDALRQKKKELQESRKKTPSAPPNYHSVLKKGRLPNGKPVFPG NGVSEGFELPTHELDRLRQHLKLAQEHLDLAFHLNPTGDNTHASRSSSPESNSIAAEQNR LNLAQEKGVGNREKSGL
Uniprot No.

Target Background

Function
Gap junctions are formed by clusters of closely packed pairs of transmembrane channels, known as connexons. These connexons facilitate the diffusion of low molecular weight materials between neighboring cells.
Database Links
Protein Families
Connexin family, Gamma-type subfamily
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.

Q&A

What is the basic structure of Xenopus tropicalis gjc1 protein?

Xenopus tropicalis gap junction gamma-1 protein (gjc1) is a 377 amino acid transmembrane protein belonging to the connexin family, gamma-type subfamily. With a molecular mass of approximately 43.2 kDa, gjc1 is characterized by four transmembrane domains (TM1-4), interdomain loops between each TM domain, and intracellular N- and C-terminus domains . Like other connexins, six gjc1 proteins assemble into a hexameric structure called a connexon, which forms one-half of a gap junction channel when paired with another connexon from an adjacent cell .

How does gjc1 compare to related connexins in other species?

While Xenopus tropicalis gjc1 shares structural and functional similarities with human GJC1 (also known as connexin-45 or GJA7), there are notable differences in amino acid sequence and potential functional adaptations. The human ortholog is 396 amino acids in length compared to the 377 amino acids of X. tropicalis gjc1 . Both proteins function as components of gap junctions that allow the diffusion of low molecular weight materials between adjacent cells. Paralogous genes include GJC2, with related pathways involving gap junction trafficking and transmission across electrical synapses . Functional studies in Xenopus laevis have revealed that the related GJA1 protein localizes not only to gap junctions but also to ciliary axonemes, suggesting diverse roles beyond direct cell-cell communication .

What experimental techniques are most suitable for initial characterization of recombinant gjc1?

For initial characterization of recombinant Xenopus tropicalis gjc1, researchers should consider:

  • Western blotting: To confirm protein expression and molecular weight (approximately 43.2 kDa)

  • Immunofluorescence microscopy: To verify subcellular localization at cell-cell junctions

  • SDS-PAGE analysis: To assess protein purity and integrity

  • Functional dye transfer assays: To test channel permeability using low molecular weight fluorescent dyes

Each technique should be optimized for the specific properties of gjc1, with particular attention to protein solubilization conditions given its transmembrane nature .

What expression systems are most effective for producing functional recombinant X. tropicalis gjc1?

Several expression systems can be used for producing functional recombinant X. tropicalis gjc1, each with specific advantages:

Expression SystemAdvantagesConsiderations
Xenopus oocytesNative post-translational modifications; allows functional electrophysiological studiesLabor-intensive; lower protein yield
Mammalian cell linesProper protein folding and trafficking; formation of functional gap junctionsHigher cost; moderate yield
Baculovirus/insect cellsHigher protein yield; eukaryotic processingMay require optimization of codon usage
E. coliHighest yield; cost-effectiveChallenging for proper folding of transmembrane proteins; may require refolding

The Xenopus oocyte system is particularly valuable despite technical challenges, as it allows direct functional assessment through electrophysiological techniques specifically designed for gap junction channels .

What are the critical factors for successful solubilization and purification of recombinant gjc1?

Successful solubilization and purification of recombinant gjc1 requires careful attention to:

  • Detergent selection: Mild detergents (e.g., digitonin, DDM, or CHAPS) are essential to maintain structural integrity and function

  • pH and ionic strength conditions: These should be optimized to maintain protein stability while preventing aggregation

  • Purification strategy: Affinity tags (His, FLAG) positioned at the C-terminus are recommended to avoid interference with channel assembly

  • Quality control: SEC-MALS (Size Exclusion Chromatography with Multi-Angle Light Scattering) to confirm hexameric assembly

  • Functional verification: Reconstitution into liposomes or lipid bilayers to assess channel activity

Recent advances in cryo-electron microscopy have enabled structural studies of connexin channels in detergents, revealing their dynamic conformational states .

How can the gap junction channel activity of recombinant gjc1 be reliably measured?

Measuring the gap junction channel activity of recombinant gjc1 can be accomplished through several complementary approaches:

  • Dual oocyte voltage-clamp recording: This technique allows direct measurement of junctional current (Ij) between two Xenopus oocytes expressing gjc1. Recent technical modifications have made this approach more accessible, including:

    • Construction of a magnetically based recording platform

    • Use of bath solution as a conductor in voltage differential electrodes

    • Adoption of commercial low-leakage KCl electrodes as reference electrodes

    • Fabrication of current and voltage electrodes from thin-wall glass capillaries

  • Dye transfer assays: Using gap junction-permeable fluorescent dyes (e.g., Lucifer Yellow) to assess intercellular communication

  • Ca²⁺ wave propagation: Monitoring the spread of calcium signals between connected cells as a functional readout

Each method provides distinct and complementary information about channel conductance, selectivity, and gating properties .

What are the key parameters to assess when analyzing gjc1 channel gating properties?

When analyzing gjc1 channel gating properties, researchers should focus on:

  • Voltage sensitivity: Characterizing how transjunctional voltage affects channel opening/closing

  • Chemical gating: Determining sensitivity to pH, Ca²⁺, and other physiological modulators

  • Single channel conductance: Measuring the unitary conductance of individual channels

  • Selectivity: Assessing permeability to different ions and small molecules

  • Kinetics: Analyzing the time course of channel opening, closing, and adaptation

Data should be quantified using appropriate electrophysiological analysis software, with statistical comparisons between experimental conditions .

What CRISPR/Cas9 strategies are most effective for studying gjc1 function in Xenopus models?

Effective CRISPR/Cas9 strategies for studying gjc1 function in Xenopus include:

  • Guide RNA design: Optimal crRNA sequences can be designed using tools like CHOPCHOP (e.g., 5'-GTCTGCAATACTCAGCAACCagg-3' has been used successfully for related connexins)

  • Delivery method: Injection of pre-assembled Cas9 protein with guide RNA (RNP) into the ventral-animal region of blastomeres at the two-cell stage (20 fmol RNP per embryo)

  • Validation approach:

    • Genomic DNA extraction from stage 28 embryos

    • PCR amplification with specific primer pairs targeting the vicinity of the guide RNA sequence

    • Sequencing analysis to confirm mutations

  • Rescue experiments: Co-injection of CRISPR/Cas9 components with an siRNA-non-targetable gjc1 mRNA containing silent mutations in the crRNA binding site

This approach allows for efficient knockout of gjc1 while maintaining the ability to perform rescue experiments to confirm specificity.

What structural biology techniques are advancing our understanding of connexin channel architecture?

Current structural biology techniques advancing connexin research include:

  • Cryo-electron microscopy (cryo-EM): This technique has revolutionized connexin structural studies by revealing the dynamic equilibrium states of various channel conformations in detergents and lipid environments. Recent cryo-EM structures of related connexins have provided insights into channel assembly, docking, and gating mechanisms .

  • X-ray crystallography: While challenging for full gap junction channels, this method has contributed to understanding connexin domains

  • Molecular dynamics simulations: These computational approaches provide insights into conformational changes during channel gating

  • Site-directed spin labeling combined with EPR spectroscopy: This technique can track dynamic structural changes during channel function

These methods are complementary and, when combined, provide comprehensive insights into gjc1 structure-function relationships .

How does gjc1 contribute to ciliogenesis in Xenopus tissues?

Research on related connexins (particularly GJA1) provides insight into potential roles of gjc1 in ciliogenesis:

  • Localization pattern: GJA1 has been shown to localize not only at cell-cell junctions but also near the apical surface as puncta and in ciliary axonemes in Xenopus multiciliated epithelial cells

  • Functional requirement: Depletion of GJA1 leads to severe defects in motile cilia formation, suggesting a crucial role in ciliogenesis

  • Mechanistic insights: GJA1 appears to function in ciliogenesis by affecting trafficking around pericentriolar regions, which is involved in cilia formation

  • Tissue-specific effects: GJA1 depletion affects both motile cilia in Xenopus epithelial tissues and primary cilia formation in human RPE1 cells, suggesting conserved functions across species and ciliary types

Given the structural and functional similarities between connexin family members, gjc1 may have analogous roles in specific developmental contexts.

What experimental approaches can differentiate between gjc1's gap junction functions and non-junction roles?

To distinguish between gjc1's gap junction and non-junction roles, researchers can employ:

  • Domain-specific mutations: Creating constructs with mutations that specifically disrupt channel formation while preserving protein expression and trafficking

  • Subcellular targeting: Using fusion proteins with localization signals to direct gjc1 to specific compartments (e.g., ciliary vs. junctional)

  • Structure-function analysis: Developing truncated proteins or chimeras to identify domains responsible for specific cellular functions

  • Temporal control: Using inducible expression systems to distinguish between developmental requirements and acute functional roles

  • Super-resolution microscopy: Precisely localizing gjc1 relative to organelles and cellular structures to infer non-canonical functions

These approaches should be combined with functional readouts specific to both gap junction communication and potential non-junction roles.

What are common pitfalls in electrophysiological studies of gjc1 and how can they be addressed?

Common pitfalls in electrophysiological studies of gjc1 include:

  • Technical challenges in dual oocyte voltage-clamp recordings:

    • Solution: Implement a magnetically based recording platform that allows precise placement of oocytes and electrodes

    • Use bath solution as a conductor in voltage differential electrodes

    • Adopt commercial low-leakage KCl electrodes as reference electrodes

  • Background endogenous connexin expression:

    • Solution: Confirm expression patterns in control samples and consider using connexin-depleted cell lines

  • Difficulty in distinguishing hemichannel vs. gap junction activity:

    • Solution: Use specific experimental conditions and blockers to isolate each component

  • Variable expression levels affecting interpretation:

    • Solution: Implement quantitative Western blotting to normalize functional data to protein expression levels

  • Series resistance errors in voltage-clamp recordings:

    • Solution: Regular monitoring and compensation of series resistance during recordings

How can researchers resolve contradictory data between different experimental systems studying gjc1?

When facing contradictory data between experimental systems:

  • Systematic comparison of experimental conditions:

    • Create a detailed table comparing key parameters across studies (expression systems, recording solutions, temperature, etc.)

    • Identify potential sources of variability

  • Cross-validation with multiple techniques:

    • Verify findings using complementary approaches (electrophysiology, imaging, biochemical assays)

    • Test key hypotheses in multiple model systems

  • Consideration of protein partnerships:

    • Analyze the expression of potential interacting proteins across different systems

    • Test whether co-expression of partner proteins resolves discrepancies

  • Quantitative modeling:

    • Develop mathematical models that can account for system-specific parameters

    • Use these models to reconcile apparently contradictory observations

  • Direct collaboration:

    • When possible, conduct side-by-side experiments with groups reporting contradictory results

    • Share reagents and detailed protocols to identify subtle methodological differences

How might single-molecule techniques advance gjc1 research beyond traditional methods?

Single-molecule techniques offer several advantages for gjc1 research:

  • Single-molecule FRET (smFRET):

    • Can reveal conformational dynamics of individual gjc1 channels

    • Allows detection of rare or transient states masked in ensemble measurements

    • Enables real-time monitoring of channel gating events

  • Super-resolution microscopy:

    • Techniques like STORM or PALM can visualize gjc1 distribution at nanoscale resolution

    • Allows precise mapping of gjc1 relative to other cellular structures

    • Can track dynamic movements of individual gjc1-containing vesicles

  • Atomic Force Microscopy (AFM):

    • Provides structural information about gjc1 channels in native-like lipid environments

    • Can measure mechanical properties relevant to channel function

  • Single-channel patch-clamp recordings:

    • Reveals heterogeneity in channel properties not detectable in whole-cell recordings

    • Can identify subconductance states and gating kinetics

These approaches are particularly valuable for understanding the molecular mechanisms of channel regulation and trafficking .

What are the most promising strategies for investigating gjc1's role in intercellular signaling networks?

Promising strategies for investigating gjc1's role in intercellular signaling include:

  • Optogenetic approaches:

    • Light-controlled modulation of gjc1 activity allows precise temporal control

    • Can be combined with fluorescent reporters to correlate channel activity with signaling events

  • Metabolomics and proteomics:

    • Identification of specific molecules exchanged through gjc1 channels

    • Characterization of the "gap junction proteome" associated with gjc1

  • Systems biology approaches:

    • Mathematical modeling of intercellular communication networks involving gjc1

    • Integration of multiple signaling pathways with gap junction communication

  • In vivo imaging in developing Xenopus embryos:

    • Real-time visualization of intercellular signaling during developmental processes

    • Correlation with gjc1 distribution and function

  • Tissue-specific and inducible genetic manipulations:

    • Allows investigation of gjc1 function in specific contexts without developmental confounds

    • Can reveal tissue-specific roles in complex signaling networks

These integrative approaches will help position gjc1 function within broader cellular communication systems rather than studying it in isolation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.