Recombinant Xenopus tropicalis GDP-Man:Man (3)GlcNAc (2)-PP-Dol alpha-1,2-mannosyltransferase (alg11)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
alg11; GDP-Man:Man(3GlcNAc(2-PP-Dol alpha-1,2-mannosyltransferase; Asparagine-linked glycosylation protein 11 homolog; Glycolipid 2-alpha-mannosyltransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-487
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
Target Protein Sequence
MAGILCLCGMMRLLTALFIPVLIASIGLCLVLVLLFICTRLWIQRKKKQSVEIGKDGKKK RVVAFFHPYCNAGGGGERVLWCALRSLQKRYKDAIYVIYTGDKDVSEEQILNGAAARFNI KLSHPVKFIFLEKRGLVEASFYPRFTLLGQSLGSVVLGWEALTKCVPDIYIDSMGYAFTL PLFKYVGGCQVGCYVHYPTISMDMLSVVRSQNARFNNAAFISNNPVLSRLKLIYYYLFAV IYGWVGSCSDVIMVNSTWTFAHILDLWKCSERTSIVYPPCDVQTFLDINLNQHKDIEEHS IVSIGQFRPEKDHPLQICAFAALLKKKTTEKLKLKLILIGGCRNNEDELRVSELKKLSSE LGIPVEFKVNIPFAELKKHLSEATIGLHTMWNEHFGIGIVECMAAGTIILAHNSGGPKLD IVVPYEEHETGFLADSVESYAAAMDYILCLTPEQRLTIRQNARRSVARFSDQEFEANFLA SSEPLFM
Uniprot No.

Target Background

Database Links
Protein Families
Glycosyltransferase group 1 family, Glycosyltransferase 4 subfamily
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is ALG11 and what is its role in N-glycosylation pathways?

ALG11 (GDP-Man:Man(3)GlcNAc(2)-PP-Dol alpha-1,2-mannosyltransferase) is a key enzyme in the lipid-linked oligosaccharide (LLO) biosynthesis pathway, which is essential for proper N-glycosylation in eukaryotes. It catalyzes the addition of the fourth and fifth mannose residues in the growing LLO chain, specifically adding α1,2-linked mannose residues to the Man(3)GlcNAc(2)-PP-Dol intermediate . This step is critical for generating the complete oligosaccharide precursor that will eventually be transferred to nascent proteins in the endoplasmic reticulum. The ALG11 enzyme demonstrates strict substrate specificity, requiring the correct stereochemistry in the GlcNAc-GlcNAc linkage of its substrate, as evidenced by the ability of subsequent pathway enzymes like yAlg1 to recognize its product .

Why is Xenopus tropicalis used as a model organism for studying ALG11 function?

Xenopus tropicalis offers several distinct advantages as a model organism for studying genes like ALG11:

  • It possesses a diploid genome with high conservation and synteny with mammalian genomes, making ortholog identification more straightforward than in models with duplicated genomes .

  • The genome is fully sequenced and well-annotated, with resources available through Xenbase (https://www.xenbase.org)[4].

  • X. tropicalis has a shorter generation time compared to X. laevis, making it more suitable for genetic studies requiring multiple generations .

  • A single breeding pair can produce over 4,000 embryos in a day, enabling high-throughput experiments .

  • CRISPR/Cas9 and other genetic modification techniques are well-established in this model, allowing efficient gene editing .

  • The unilateral mutation technique (targeting one cell at the 2-cell stage) creates embryos with one wild-type half and one mutant half, providing an internal control .

These advantages make X. tropicalis particularly valuable for studying conserved proteins like ALG11 that are involved in fundamental cellular processes such as glycosylation.

How should recombinant Xenopus tropicalis ALG11 protein be reconstituted and stored for optimal activity?

For optimal reconstitution and storage of recombinant X. tropicalis ALG11:

  • Reconstitution protocol:

    • Briefly centrifuge the vial containing lyophilized protein before opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended as default)

    • Aliquot to avoid repeated freeze-thaw cycles

  • Storage conditions:

    • Long-term storage: -20°C/-80°C in aliquots containing glycerol

    • Working aliquots: 4°C for up to one week

    • Avoid repeated freeze-thaw cycles as this significantly reduces enzyme activity

The recombinant protein is typically supplied as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during the freeze-drying process . Following these handling procedures ensures maximum retention of enzymatic activity for experimental use.

How can CRISPR/Cas9 be optimized for generating X. tropicalis ALG11 mutants to model glycosylation disorders?

Optimizing CRISPR/Cas9 for X. tropicalis ALG11 mutant generation requires careful consideration of several factors:

  • gRNA design strategy:

    • Target conserved functional domains (active sites, substrate binding regions)

    • Use multiple gRNAs to increase editing efficiency (2-3 per target)

    • Validate gRNA efficiency using in vitro assays before embryo injection

    • Consider targeting different exons to create allelic series

  • Injection protocols:

    • For F0 analysis: inject one cell at 2-cell stage for unilateral mutations providing internal controls

    • For germline transmission: inject at 1-cell stage

    • Optimal concentrations: 1-1.5 ng Cas9 protein with 400 pg gRNA per embryo

  • Validation approaches:

    • Perform T7 endonuclease I assays on PCR products from targeted regions

    • Use high-resolution melt analysis (HRMA) for rapid screening

    • Sequence verify mutations and predict protein impacts

    • Validate functional consequences using enzymatic assays

  • Phenotypic analysis:

    • Assess glycosylation status using lectin staining, glycoprotein analysis

    • Examine tissue-specific glycosylation defects in neural tissues, heart, kidney

    • Compare phenotypes to human ALG11-CDG clinical manifestations

When modeling ALG11-CDG, researchers should consider creating both null mutations and specific missense mutations that mimic human pathogenic variants. For example, variants similar to the p.G160V mutation found in human patients could be engineered to study specific disease mechanisms rather than complete loss-of-function.

How does X. tropicalis ALG11 function compare with human ALG11 in terms of substrate specificity and potential for complementation studies?

X. tropicalis and human ALG11 show important similarities and differences that impact experimental approaches:

Similarities:

  • Both enzymes catalyze the same reaction steps in N-glycosylation pathways

  • High sequence conservation in functional domains

  • Both require dolichol-linked substrates rather than artificial analogs

  • Both are involved in conserved LLO synthesis pathways essential for proper glycosylation

Differences and experimental implications:

  • Substrate specificity differences:
    Unlike yeast Alg enzymes which can utilize artificial substrates like phytanyl-linked oligosaccharides, human ALG enzymes (and likely X. tropicalis enzymes) show stricter substrate requirements, necessitating natural dolichol-linked substrates for in vitro assays .

  • Cross-species complementation potential:
    While not specifically documented for ALG11, studies of related glycosylation enzymes have shown that X. tropicalis orthologs can often functionally rescue mammalian cell lines with corresponding gene knockouts, indicating functional conservation .

  • Methodological approaches for comparative studies:

    • Express both human and X. tropicalis ALG11 in ALG11-deficient yeast strains to assess functional complementation

    • Compare enzyme kinetics using standardized in vitro assays with identical substrates

    • Perform structural analysis to identify species-specific domains that might influence function

    • Test cross-species chimeric constructs to identify functional domains

This conservation of function makes X. tropicalis an excellent model for studying human glycosylation disorders, though researchers must remain aware of potential species-specific differences when translating findings to human disease contexts.

What are common pitfalls when working with recombinant ALG11 and how can they be addressed?

Several challenges can arise when working with recombinant ALG11:

ChallengePossible CausesSolutions
Low enzymatic activity- Improper reconstitution
- Protein denaturation
- Suboptimal buffer conditions
- Lack of essential cofactors
- Follow strict reconstitution protocols
- Optimize buffer conditions (pH, salt)
- Test different metal ions and cofactors
- Verify protein integrity by SDS-PAGE
Substrate accessibility issues- Improper substrate preparation
- Lipid solubility problems
- Incorrect stereochemistry
- Use natural dolichol-linked substrates
- Include appropriate detergents
- Verify substrate structure
Protein-protein interaction failures- Missing interaction partners
- Buffer conditions disrupting interactions
- Consider co-expression with known partners
- Test different buffer compositions
- Use cross-linking approaches to stabilize complexes
Inconsistent results between assays- Batch variation in recombinant protein
- Variable substrate quality
- Inconsistent assay conditions
- Use internal controls
- Standardize protocols
- Prepare larger batches of reagents

Unlike other ALG glycosyltransferases, ALG11 does not require metal ion coordination for its activity, which is an important consideration when designing buffer systems for in vitro assays . When troubleshooting activity issues, researchers should first verify protein quality through SDS-PAGE and consider whether interacting partners might be necessary for full functionality, as has been demonstrated with related enzymes like the ALG13/14 complex .

How can researchers distinguish between phenotypes caused by ALG11 mutation versus general disruption of N-glycosylation pathways in X. tropicalis models?

Distinguishing ALG11-specific phenotypes from general N-glycosylation disruption requires multi-level analysis:

  • Biochemical profiling:

    • Analyze LLO intermediates by HPLC or mass spectrometry to detect specific accumulation of Man3GlcNAc2-PP-Dol (the ALG11 substrate)

    • Perform enzymatic assays using ALG11-specific substrates

    • Compare glycoprotein patterns using lectin blotting with multiple lectins to detect specific glycan alterations

  • Genetic approaches:

    • Create rescue experiments using wild-type ALG11 and catalytically inactive mutants

    • Generate comparative models with mutations in other glycosylation pathway enzymes

    • Use the unilateral CRISPR approach in X. tropicalis to directly compare mutant and wild-type tissues within the same animal

  • Phenotypic analysis techniques:

    • Implement tissue-specific markers to identify affected cell types

    • Perform temporal analysis of phenotype progression

    • Compare to phenotypes observed in other glycosylation pathway mutants

    • Correlate findings with human ALG11-CDG patient data

  • Data interpretation framework:

    ALG11-specific effects should show:

    • Rescue with wild-type ALG11 but not with catalytically inactive mutants

    • Accumulation of specific LLO intermediates

    • Partial overlap but distinct differences from other glycosylation pathway mutants

    • Correlation with human ALG11-CDG patient phenotypes such as psychomotor disability, microcephaly, and seizures

This multi-faceted approach allows researchers to confidently distinguish between ALG11-specific effects and general disruption of N-glycosylation pathways, crucial for accurate disease modeling and potential therapeutic development.

How can X. tropicalis ALG11 mutants contribute to understanding human congenital disorders of glycosylation (CDG)?

X. tropicalis ALG11 mutants offer unique advantages for studying human ALG11-CDG through several approaches:

  • Phenotypic correlation:
    X. tropicalis ALG11 mutants can be assessed for features that parallel human ALG11-CDG symptoms, such as developmental delay, neurological abnormalities, and organ system defects. The transparent nature of tadpoles allows real-time visualization of developing organ systems affected in human patients .

  • Mechanistic insights:

    • Investigate how ALG11 deficiency affects specific tissue types during development

    • Examine the temporal requirements for ALG11 function in different developmental contexts

    • Study compensatory mechanisms that might explain variable expressivity in human patients

  • Therapeutic screening:

    • Test dietary interventions (e.g., mannose supplementation)

    • Screen small molecule libraries for compounds that rescue phenotypes

    • Evaluate gene therapy approaches using the high-throughput capacity of X. tropicalis

  • Advantages over other models:
    X. tropicalis provides a vertebrate system with considerable genetic conservation with humans, while offering experimental advantages over mammalian models, including:

    • Ability to produce large numbers of mutant embryos quickly

    • External development allowing direct observation

    • Cost-effective husbandry compared to rodent models

    • Capacity for unilateral mutations providing internal controls

Human ALG11-CDG presents with severe psychomotor disability, progressive microcephaly, seizures, and other symptoms . X. tropicalis models can help elucidate the developmental origins of these clinical features and potentially identify critical windows for intervention.

What are emerging techniques for studying ALG11 function in the context of the complete N-glycosylation pathway?

Several cutting-edge approaches are advancing our understanding of ALG11 within the N-glycosylation pathway:

  • Single-cell transcriptomic profiling:

    • Identify co-expression patterns of ALG11 with other glycosylation enzymes across development

    • Map temporal and spatial expression in X. tropicalis embryos

    • Compare expression patterns between normal and disease states

  • Cryo-EM structural analysis:

    • Determine 3D structures of ALG11 alone and in complex with interaction partners

    • Identify substrate binding sites and catalytic residues

    • Compare structures across species to identify conserved functional domains

  • Glycoproteomics approaches:

    • Use mass spectrometry to identify specific glycoproteins affected by ALG11 dysfunction

    • Characterize tissue-specific glycosylation patterns in normal and ALG11-deficient states

    • Develop targeted glycan analysis methods for high-throughput screening

  • Integrative multi-omics platforms:

    • Combine glycomics, proteomics, and transcriptomics data to build comprehensive models

    • Identify regulatory networks controlling ALG11 expression and function

    • Map the impacts of ALG11 deficiency across multiple cellular systems

  • Live imaging of glycosylation dynamics:

    • Develop fluorescent markers for real-time visualization of glycosylation in living X. tropicalis embryos

    • Track trafficking of glycoproteins in normal and ALG11-deficient cells

    • Correlate glycosylation defects with cellular behavior during development

These advanced methodologies are enabling researchers to move beyond studying individual glycosylation enzymes in isolation toward understanding their integrated functions within comprehensive cellular networks, with important implications for basic biology and human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.