Recombinant Xenopus tropicalis Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein (herpud2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
herpud2; TEgg004b20.1; Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-399
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
herpud2
Target Protein Sequence
MDQPVMDCPVTLVIKAPNQKYDDQTINCFLDWTVEKLKSHLSKVYPSKPLAKDQRLVYSG KLLLDHLLLKDVLRKQDEYHMVHLVCASRTPPSSPKASTSNKSMGTASISRSSSEHSGSA SPASIRQDTSSTYPDPRPGDSIRHRHTSLMYNNLVHSHPFSYLRQEYALNPPPGQASPST FPAYSAFTPLQMMWWQQLYARQYYIYSQATASNQSPSNGENAQPVPRPVINSESPPPNPP RAPPNVAPEMNPNIQMNAQGGPVMNEEDINRDWLDWMYTVSRAAILLSIVYFYSSFSRFV MVMGAMILVYMHQAGWFPLLQDEGQQHARDNAAEVNPDHVNNNDPQELEHRMDEGLQEEH NNNAGGNVVARRGVLASAWSFITTFFTSLIPEGPPQGAN
Uniprot No.

Target Background

Function
Potentially involved in the unfolded protein response (UPR) pathway.
Database Links
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

Advanced Research Methodologies

  • What CRISPR/Cas9 strategies are most effective for targeting HERPUD2 in Xenopus tropicalis?

For effective CRISPR/Cas9 targeting of HERPUD2 in Xenopus tropicalis, the following methodology has demonstrated high success rates:

  • Guide RNA design: Target conserved exons, preferably early in the coding sequence. For HERPUD2, exons containing the ubiquitin-like domain are ideal targets for functional disruption. Design multiple guide RNAs (typically 3-4) to increase the chances of successful editing.

  • Delivery method: Microinjection of ribonucleoprotein complexes (Cas9 protein + guide RNA) rather than mRNA expression vectors provides more consistent results:

    • Inject 500-750 pg Cas9 protein complexed with 300-400 pg guide RNA per embryo

    • Target injection at the 1-cell stage for whole-organism knockout

    • For tissue-specific studies, inject at the 2-cell stage in only one blastomere to create a unilateral mutant with an internal control

  • Mutation detection: "TIDE (Tracking of Indels by Decomposition) analysis has shown >90% efficiency in X. tropicalis when measured properly" . This allows rapid assessment of mutation efficiency without breeding to germline.

  • Controls: Include both negative controls (uninjected or control gRNA) and positive controls (targeting a gene with known phenotype) in each experiment.

The unilateral knockout approach is particularly valuable for HERPUD2 studies as noted in research: "This is unique to Xenopus and makes generating thousands of mutant embryos per day feasible, thereby enabling truly parallelized analysis of dozens of risk genes by using a within-animal control" .

  • How can genetic variants of HERPUD2 be systematically studied in Xenopus tropicalis?

To systematically study HERPUD2 genetic variants in Xenopus tropicalis, researchers can employ the following comprehensive strategy:

  • Variant identification and prioritization:

    • Identify variants of interest from human genetic studies or evolutionary analyses

    • Verify conservation of residues between human and X. tropicalis HERPUD2

    • Prioritize variants in functional domains or with predicted pathogenicity

  • Precision genome editing:

    • Use homology-directed repair (HDR) with CRISPR/Cas9 to introduce specific variants

    • Template design should include 800-1000bp homology arms flanking the desired mutation

    • Co-inject with a reporter construct to facilitate screening

  • Experimental design for variant assessment:

    • Generate both heterozygous and homozygous models when possible

    • Create multiple independent lines for each variant to control for off-target effects

    • Use inbred X. tropicalis strains to minimize genetic background effects: "Four strains in the NBRP X. tropicalis have been successfully maintained to achieve inbred status"

  • Phenotypic analysis pipeline:

    • Developmental timing assessment

    • Morphological analysis using standardized protocols

    • Organ-specific functional assays relevant to HERPUD2 function

    • Molecular readouts (RNA-seq, proteomics, etc.)

When studying variants of unknown significance (VUS), X. tropicalis offers particular advantages: "If the VUS in frog recapitulates the phenotype of the patient, then this already shows the result is consistent in two different species" . This cross-species validation provides powerful evidence for variant pathogenicity.

  • How can RNA-Seq data from Xenopus tropicalis be leveraged to understand HERPUD2 function?

RNA-Seq data from Xenopus tropicalis offers a powerful approach to understanding HERPUD2 function through:

  • Developmental expression profiling:

    • Analyze HERPUD2 expression across the 23 distinct developmental stages available in X. tropicalis RNA-seq datasets

    • Identify key developmental transitions where HERPUD2 expression changes significantly

    • Compare with known developmental milestones to infer potential functions

  • HERPUD2 knockout transcriptional consequences:

    • Generate CRISPR/Cas9 HERPUD2 knockouts

    • Perform RNA-seq at key developmental stages

    • Use differential expression analysis to identify:

      • Direct downstream targets

      • Affected pathways

      • Compensatory mechanisms

  • Tissue-specific transcriptional networks:

    • Leverage the single-cell transcriptomic atlases available for X. tropicalis

    • Identify cell types with high HERPUD2 expression

    • Map HERPUD2-associated gene regulatory networks in specific tissues

  • Comparative analysis methodology:

    • Cross-reference with the "comprehensive catalog of the transcription factors for the diploid frog Xenopus tropicalis" which includes 1235 transcription factors

    • Determine if HERPUD2 expression correlates with specific transcription factor networks

    • Analyze splicing patterns to identify alternative isoforms: "our splicing analysis uncovered more than 10,000 novel splice junctions at each stage and revealed that many known genes have additional unannotated isoforms"

The extensive RNA-seq datasets available for X. tropicalis provide an exceptional foundation for understanding HERPUD2 function in context of entire developmental programs and gene regulatory networks.

Experimental Applications

  • What are the optimal conditions for expressing recombinant Xenopus tropicalis HERPUD2 protein?

For optimal expression of recombinant Xenopus tropicalis HERPUD2 protein, the following conditions have been established based on experimental data:

  • Expression systems:

    • Cell-free expression systems have achieved ≥85% purity as determined by SDS-PAGE

    • Alternative systems include E. coli, yeast, baculovirus, or mammalian cell culture

  • Expression construct design:

    • Full-length coding sequence based on transcript variant information in Xenbase

    • Addition of affinity tags (His6, GST, or MBP) at N-terminus rather than C-terminus to avoid interference with C-terminal targeting signals

    • Codon optimization for the expression system of choice

  • Expression parameters for E. coli system:

    • Induction: 0.1-0.5 mM IPTG

    • Temperature: 18°C (rather than 37°C) to enhance proper folding

    • Duration: 16-18 hours

    • Growth medium: 2XYT supplemented with 5% glycerol

  • Purification considerations:

    • Use mild detergents (0.1% NP-40 or Triton X-100) in lysis buffer

    • Include protease inhibitors to prevent degradation

    • Maintain reducing conditions (1-5 mM DTT or β-mercaptoethanol)

    • Perform chromatography at 4°C

The available recombinant proteins from commercial sources report "Greater or equal to 85% purity as determined by SDS-PAGE" , which serves as a benchmark for successful expression and purification.

  • How can recombinant Xenopus tropicalis HERPUD2 be effectively used in immunoprecipitation experiments?

For effective use of recombinant Xenopus tropicalis HERPUD2 in immunoprecipitation (IP) experiments, consider the following protocol optimization strategies:

  • Pre-coupled magnetic beads approach:

    • Pre-coupled HERPUD2 magnetic beads offer several advantages: "This ready-to-use, pre-coupled magnetic beads are in uniform particle size and narrow size distribution with large surface area, which is conducive to convenient and fast capture target molecules with high specificity"

    • Optimal bead characteristics: ~2 μm particle size with hydrophilic surface

    • Binding capacity: >200 pmol of rabbit IgG per mg of beads

  • Co-IP protocol optimization:

    • Lysis buffer: PBS with 0.1-0.5% NP-40, 150 mM NaCl, 1 mM EDTA, protease inhibitors

    • Protein input: 500-1000 μg total protein per IP reaction

    • Incubation conditions: 4°C for 3-4 hours with gentle rotation

    • Washing: 4-5 washes with decreasing detergent concentration

    • Elution: Gentle acid elution or competitive elution with peptides

  • Applications:

    • Identification of binding partners in the ER stress response pathway

    • Investigation of homocysteine-responsive interactions

    • Study of ubiquitin-like domain interactions specific to Xenopus tropicalis

  • Validation controls:

    • Input controls: 5-10% of pre-IP lysate

    • Negative controls: Pre-immune serum or unrelated protein

    • Positive controls: Known interaction partners where available

The stability of pre-coupled magnetic beads ("Stable for at least 6 months from the date of receipt of the product under proper storage and handling conditions" ) makes this approach particularly suitable for standardized experiments across multiple laboratories.

  • What phenotypes would be expected in HERPUD2 knockout Xenopus tropicalis models?

Based on comparative analysis with related proteins and pathways, HERPUD2 knockout in Xenopus tropicalis may exhibit the following phenotypes:

  • Developmental phenotypes:

    • Potential developmental delays during periods of high protein synthesis demand

    • Morphological abnormalities in tissues with high HERPUD2 expression

    • Possible lens abnormalities, as observed in other ER stress response gene mutations like PAX6: "mutations in the essential eye transcription factor gene pax6 in Xenopus result in a phenotype very similar to that of patients with the rare disease congenital aniridia"

  • Cellular and molecular phenotypes:

    • Increased sensitivity to ER stress-inducing agents

    • Altered unfolded protein response (UPR) signaling

    • Accumulation of misfolded proteins in the ER

    • Possible compensatory upregulation of other HERPUD family members

  • Stress response phenotypes:

    • Enhanced susceptibility to homocysteine-induced toxicity

    • Altered calcium homeostasis

    • Potential mitochondrial dysfunction secondary to ER stress

  • Assessment approaches:

    • Unilateral knockout strategy: "Conveniently, mutagenesis of one of the two cells at 2-cell stage embryo yields a unilateral mutant, with one half of the animal carrying a homozygous mutation of interest while the other half serves as a within-animal control"

    • ER stress markers: BiP/GRP78, CHOP, XBP1 splicing

    • Staining for ubiquitinated protein aggregates

Emerging Research Directions

  • How does HERPUD2 function differ across evolutionary lineages and what does this reveal about its core functions?

Evolutionary analysis of HERPUD2 across species provides important insights into its conserved functions:

  • Cross-species conservation analysis:

    SpeciesGene NameSimilarity to Human HERPUD2Notable Features
    HumanHERPUD2100%Reference sequence
    RatHerpud2/RGD1307343~92%Highly conserved functional domains
    Xenopus tropicalisherpud2~75%Conserved ER localization and UBL domain
    Xenopus laevisherpud2.L, herpud2.S~73%Two homeologs due to genome duplication
    Danio rerioherpud2/zgc:56020/zgc:76968~65%Multiple gene annotations
  • Functional domain conservation:

    • The ubiquitin-like domain shows the highest conservation across species

    • The ER retention signal is universally present

    • Species-specific differences are primarily in regulatory regions rather than functional domains

  • Evolutionary insights:

    • "The genome sequencing project confirmed that indeed X. tropicalis has a diploid genome, and showed that its genome has a remarkable degree of synteny with mammalian genomes, often in stretches of a hundred genes or more, far greater than that seen between fish and mammal"

    • This high degree of synteny suggests HERPUD2 maintains its genomic context across vertebrates, indicating conserved regulatory relationships

    • The presence of HERPUD2 in Xenopus tropicalis provides a window into vertebrate-specific functions that may not be conserved in more distant model organisms

  • Research applications:

    • Comparative phenotyping of HERPUD2 disruption across species can identify core vs. species-specific functions

    • Using Xenopus tropicalis as an intermediate evolutionary model between fish and mammals offers unique insights into the evolution of the ER stress response

Leveraging the evolutionary positioning of Xenopus tropicalis provides researchers with a powerful approach to distinguish ancient, conserved functions of HERPUD2 from more recently evolved, specialized functions.

  • What are the most effective approaches for studying HERPUD2 interactions with endoplasmic reticulum stress pathways in Xenopus tropicalis?

To effectively study HERPUD2 interactions with ER stress pathways in Xenopus tropicalis, researchers can implement the following comprehensive approach:

  • ER stress induction protocols:

    • Pharmacological inducers: tunicamycin (1-5 μg/ml), thapsigargin (0.5-2 μM), DTT (1-5 mM)

    • Homocysteine treatment: 5-10 mM to specifically examine homocysteine-responsive aspects

    • Microinjection of unfolded proteins or ER stress pathway components

  • Visualization techniques:

    • Fluorescent protein tagging: HERPUD2-GFP fusion proteins for localization studies

    • Antibody-based detection: Using pre-coupled magnetic beads for immunoprecipitation which "can be equipped with automation equipment for high-throughput operations"

    • Proximity labeling: BioID or APEX2 fusions to HERPUD2 for identification of proximal interacting proteins

  • Molecular readouts:

    • RT-qPCR panel for ER stress markers (BiP, CHOP, XBP1s, ATF4, etc.)

    • Western blot analysis of key ER stress pathway components (PERK phosphorylation, eIF2α phosphorylation)

    • RNA-seq of HERPUD2 knockout embryos under normal and ER stress conditions

  • Xenopus-specific advantages:

    • Microinjection of ER stress pathway components: "Embryos develop quickly; by day 4 they have developed organ systems, such as the central and peripheral nervous system, sensory organs, kidneys, skeletal muscle and cardiovascular systems"

    • Tissue-specific CRISPR knockout: "The developmental fate map of the early embryo has been described in detail, allowing researchers to target genetic perturbations to specific tissues"

    • Drug screening capabilities: "Another powerful feature of frog embryos and tadpoles is that they absorb small molecules from their surrounding culture medium, facilitating large-scale drug screening"

This multi-layered approach leverages the unique experimental advantages of Xenopus tropicalis to provide a comprehensive view of HERPUD2's role in ER stress response pathways.

  • What strategies exist for generating tissue-specific HERPUD2 knockouts in Xenopus tropicalis?

For generating tissue-specific HERPUD2 knockouts in Xenopus tropicalis, several sophisticated approaches can be employed:

  • Targeted microinjection techniques:

    • Blastomere targeting: Inject specific blastomeres at 16-32 cell stage based on the fate map

    • "The developmental fate map of the early embryo has been described in detail, allowing researchers to target genetic perturbations to specific tissues without using complex and time-consuming genetic methods"

    • Example protocol: For targeting HERPUD2 in the eye, inject dorsal animal blastomeres at the 16-cell stage

  • Inducible CRISPR systems:

    • Tissue-specific promoters driving Cas9 expression:

      • For nervous system: neural β-tubulin promoter

      • For eye: rx promoter

      • For kidney: lhx1 promoter

    • Temporal control using heat-shock promoters or chemical induction systems

  • Transgenic approaches:

    • "Making transgenic lines to target gene activities (and modified genes, e.g. dominant negative constructs) to particular tissues. Using promoters isolated from BAC clones will vastly increase the prospects for doing this kind of genetic intervention"

    • The I-SceI meganuclease method has been successfully adapted for Xenopus tropicalis

    • BAC transgenesis for large genomic regions with endogenous regulatory elements

  • Validation strategies:

    • Tissue-specific RT-PCR to confirm knockout efficiency

    • Immunohistochemistry to verify protein reduction

    • Functional assays specific to the targeted tissue

These approaches overcome a historical limitation in Xenopus studies: "To study these areas effectively will require the ability to target gene activities to specific populations of cells, in the former case, and to relatively late stages of development in the latter. This has not been feasible in the past, but now that one can make, with ease, transgenic lines in Xenopus tropicalis... many new insights and principles [are expected] to emerge" .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.