Recombinant Xenopus tropicalis Hyaluronan synthase 1 (has1)

Shipped with Ice Packs
In Stock

Description

Substrate Requirements and Activity

Recombinant HAS1 requires high cellular UDP-sugar concentrations for activation . Comparative studies reveal:

ParameterHAS1HAS2HAS3
Substrate Affinity (UDP-GlcUA)Low (K<sub>m</sub> ~2× higher) High Intermediate
Substrate Affinity (UDP-GlcNAc)Low (K<sub>m</sub> ~2–3× higher) High Intermediate
HA Polymer SizeSmall (~0.12 × 10<sup>6</sup> Da in vitro) Largest (>3.9 × 10<sup>6</sup> Da) Intermediate (0.12–1 × 10<sup>6</sup> Da)

HAS1 produces a diffuse, "cloudy" pericellular HA coat dependent on CD44 interactions, unlike the dense coats formed by HAS2/3 . Activity is enhanced by glucosamine (1 mM), which elevates UDP-GlcNAc levels .

Inflammatory and Disease Models

  • Cartilage Injury: Has1<sup>-/-</sup> mice exhibit chronic joint inflammation and fibrotic scarring post-injury, linked to dysregulated IL-17/IL-6 signaling and apoptosis . Despite normal bulk HA levels, HAS1 deficiency disrupts inflammatory HA matrix metabolism .

  • Cancer: Aberrant HAS1 splicing in malignancies correlates with genetic instability and poor prognosis . Overexpression in MCF-7 cells increases HA production under glycemic stress .

  • Inflammation: HA synthesized by HAS1 recruits monocytes more effectively than HAS2/3-derived HA, implicating it in chronic inflammatory diseases .

Recombinant Protein Utilization

  • Expression: Optimized in E. coli with codon adaptation for eukaryotic transmembrane domains .

  • Storage: Stable at -20°C or -80°C in glycerol-containing buffers .

  • Limitations: Requires exogenous UDP-sugars for activity in vitro; no commercial activity assays are validated .

Key Findings from Studies

  • Substrate Induction: Glucosamine (1–5 mM) boosts HA coat thickness in HAS1-transfected COS-1 cells by 3-fold .

  • Localization: Predominantly intracellular in unstimulated cells; inflammatory cytokines (e.g., IL-1β) promote membrane trafficking .

  • Regulatory Pathways: NF-κB and p38 MAPK mediate HAS1 upregulation during hyperglycemia or TGF-β stimulation .

Comparative Analysis with Mammalian Isoforms

FeatureXenopus HAS1Human HAS1
Embryonic ViabilityNon-essential Non-essential
Transcriptional RegulationInduced by IL-1β, TGF-β Induced by IL-1β, TGF-β
HA Matrix RolePro-inflammatory Tumor progression

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference point for your own preparations.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development accordingly.
Synonyms
has1; Hyaluronan synthase 1; Hyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-590
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
has1
Target Protein Sequence
MKDKAAATMEIPEDPGIPKNLERKRPIVWRMIYYSFAVLLLAAFTAAYVTEFQILTHEDV LFSLGLYGLVMFLHLMMQSLFAYLEIRRINKTDLPCSFKKTVALTIAGYQENPDYLKHCL DSCRYVKYPKDKLKIILVIDGNTEDDAYMMEMFKDVFHGDDVGTYVWKGNYHTGVKETQD GSCPEVSKPLNEDEGIRIVEELVRTKRCVCIMQQWGGKREVMYTAFRAIGTTMDYVQVCD SDTKLDELATVEMVKVLEANELCGAVGGDVRILNPYDSFISFMSSLRYWMAFNVERACQS YFDCVSCISGPLGMYRNDILQVFLEAWHSQKFLGTYCTLGDDRHLTNRVLSMGYRTKYTP KCRAFSETPSQYLRWLNQQTRWTKSYFREWLYNAQWWYKHHIWMTYESVVHFIFPFFITA TVIRLLYASTIWNVVWLLLCIQIMSVLKSLYACWLRGNPIMLLMSLYSMLYMTGLLPSKY FAMLTINKSGWGTSGRKKIVGNYMPVLPLSIWMAVLCGGVGYSIYMDCHQDWSTPEKQKE LYHLLYGCISYTLYWVLMALMYWVWVKRCCRKRSQTVTLVHDIPERLVCK
Uniprot No.

Target Background

Function
This enzyme catalyzes the addition of GlcNAc or GlcUA monosaccharides to the nascent hyaluronan polymer. As such, it plays a critical role in hyaluronan synthesis, a major component of most extracellular matrices. Hyaluronan has a structural role in tissue architecture and regulates cell adhesion, migration, and differentiation. This enzyme can also catalyze the synthesis of chito-oligosaccharide depending on the substrate.
Database Links

KEGG: xtr:100145746

UniGene: Str.8178

Protein Families
NodC/HAS family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis Hyaluronan synthase 1 and why is it significant in research?

Hyaluronan synthase 1 (has1) is an enzyme responsible for synthesizing hyaluronan (also known as hyaluronic acid), a critical component of the extracellular matrix. In Xenopus tropicalis, has1 belongs to a family of conserved membrane-bound glycosyltransferases that play essential roles in embryonic development, tissue morphogenesis, and cell signaling. The significance of has1 in research stems from its evolutionary conservation across vertebrates and its involvement in fundamental developmental processes .

Xenopus tropicalis has emerged as a valuable model organism for studying these processes due to its diploid genome, which facilitates genetic manipulation and analysis compared to the allotetraploid Xenopus laevis . The study of has1 in X. tropicalis provides insights into developmental mechanisms that are relevant to human genetic disorders, particularly those affecting extracellular matrix formation and tissue morphogenesis.

What are the molecular specifications of recombinant Xenopus tropicalis has1?

The recombinant Xenopus tropicalis has1 protein has the following molecular characteristics:

SpecificationDetails
Molecular Weight44.9 kDa
TagsN-Terminal 10xHis-Tagged and C-Terminal Myc-Tagged
Expression SourceE. coli
Purity>85% by SDS-PAGE
Sequence CoveragePartial (amino acids 82-401)
SynonymsHyaluronate synthase 1; Hyaluronic acid synthase 1; HA synthase 1
OrganismXenopus tropicalis (Western clawed frog)(Silurana tropicalis)
Accession NumberB1WB39

This recombinant form represents a partial sequence of the native protein, containing the catalytically critical central domain while excluding portions of the N-terminal and C-terminal regions . The dual tagging system (His and Myc) facilitates both purification and immunodetection in experimental applications.

How does Xenopus tropicalis has1 compare structurally and functionally to orthologues in other species?

Xenopus tropicalis has1 shares significant sequence homology with has1 proteins from other vertebrates, reflecting its evolutionary conservation. Comparative analyses have revealed:

  • The Xenopus has1 shares approximately 55-56% amino acid identity with mouse HAS2, demonstrating the conservation of core functional domains across vertebrate species .

  • Xenopus has1 exhibits structural similarities to bacterial hyaluronan synthases, such as Streptococcus pyogenes HasA, with which it shares approximately 21% sequence identity in key catalytic regions .

  • Xenopus has1 (from both X. laevis and X. tropicalis) is more closely related to the developmental gene DG42, which plays crucial roles during gastrulation and neurulation in amphibian embryos .

The functional conservation between Xenopus has1 and its mammalian counterparts makes it an excellent model for understanding the basic mechanisms of hyaluronan synthesis that are relevant to human development and disease.

What are the optimal expression systems for producing active recombinant Xenopus tropicalis has1?

While E. coli is commonly used for expression of recombinant Xenopus tropicalis has1 as evidenced by commercial preparations , researchers should consider several expression systems based on experimental needs:

  • Bacterial Expression (E. coli):

    • Advantages: High yield, cost-effective, rapid production

    • Limitations: Potential issues with protein folding and post-translational modifications

    • Best for: Structural studies, antibody production, and applications not requiring glycosylation

    • Purification strategy: Affinity chromatography using N-terminal His-tag

  • Xenopus Oocyte Expression:

    • Advantages: Native-like post-translational modifications, membrane integration

    • Limitations: Lower yield, more technically demanding

    • Best for: Functional studies requiring proper membrane topology and enzymatic activity

    • Methodology: mRNA microinjection followed by membrane isolation

  • Mammalian Cell Expression (COS cells, HEK293):

    • Advantages: Proper folding and post-translational modifications

    • Applications: Functional assays, particle exclusion assays to visualize hyaluronan coat formation

    • Evidence: Successful demonstration with related hyaluronan synthases in transfection experiments

The choice of expression system should be guided by the specific research question, particularly whether structural or functional aspects of has1 are being investigated.

What techniques are most effective for studying has1 function in Xenopus embryos?

Several approaches have proven effective for investigating has1 function in Xenopus embryos:

  • CRISPR/Cas9-mediated gene editing:

    • Particularly suitable for X. tropicalis due to its diploid genome

    • Enables precise knockout or knockin mutations

    • Allows investigation of complete loss-of-function phenotypes

  • Morpholino-mediated knockdown:

    • Advantages: Allows titration of gene dosage to mimic human haploinsufficiency conditions

    • Can be targeted to specific embryonic regions or tissues

    • Valuable for studying dose-dependent effects on development

  • mRNA overexpression:

    • Methodology: Microinjection of synthetic has1 mRNA into early embryos

    • Applications: Rescue experiments, structure-function analyses, gain-of-function studies

    • Can be combined with fluorescent protein tags for localization studies

  • Tissue transplantation assays:

    • Particularly valuable for studying tissue-specific functions

    • Allows discrimination between cell-autonomous and non-cell-autonomous effects

    • Example applications: Neural crest cell transplants, facial transplants

  • In situ hybridization and immunohistochemistry:

    • For analyzing has1 expression patterns during development

    • Can be combined with other markers to study cellular contexts

These approaches can be deployed individually or in combination to comprehensively investigate has1 function throughout different developmental stages and tissue contexts.

How can researchers verify the enzymatic activity of recombinant has1?

Verification of enzymatic activity for recombinant Xenopus tropicalis has1 can be achieved through several complementary methods:

  • Particle exclusion assay:

    • Methodology: Transfect cells with has1 expression constructs and visualize hyaluronan coat formation

    • Red blood cells are typically used as visual indicators as they are excluded by the hyaluronan matrix

    • This approach has been successfully used for related hyaluronan synthases

  • Radiometric assay:

    • Measure incorporation of radiolabeled substrates (UDP-[14C]GlcUA and UDP-[3H]GlcNAc) into high molecular weight hyaluronan

    • Quantify enzymatic activity through scintillation counting

  • Hyaluronan quantification:

    • ELISA-based methods using hyaluronan-binding proteins

    • Size-exclusion chromatography coupled with refractive index detection

    • Mass spectrometry for detailed product characterization

  • Functional complementation:

    • Expression of recombinant has1 in hyaluronan synthase-deficient cells

    • Assessment of phenotype rescue as evidence of enzymatic activity

When reporting enzymatic activity, researchers should include appropriate controls and standardized conditions to ensure reproducibility and meaningful comparisons across different experimental contexts.

How can Xenopus tropicalis has1 studies contribute to understanding human developmental disorders?

Xenopus tropicalis has1 research offers valuable insights into human developmental disorders through several mechanisms:

  • Conserved developmental pathways:

    • Xenopus shares a high degree of synteny with humans, and a majority of disease-associated genes are conserved between these species

    • The rapid external development of Xenopus embryos allows for efficient analysis of gene function during key developmental processes relevant to human disorders

  • Modeling genetic dosage effects:

    • Many human disorders result from haploinsufficiency (e.g., Wolf-Hirschhorn Syndrome)

    • Xenopus models allow titration of gene expression to mimic human haploinsufficiency conditions

    • This approach can reveal how reduced has1 levels affect extracellular matrix composition and subsequent developmental processes

  • Combinatorial gene analysis:

    • Xenopus facilitates the simultaneous manipulation of multiple genes

    • This advantage is particularly relevant for studying multigenic disorders where has1 dysfunction may interact with other genetic factors

  • Tissue-specific phenotyping:

    • Xenopus has been successfully used to study craniofacial abnormalities, heart defects, brain development, and kidney formation—all systems potentially affected by extracellular matrix disruption

    • These studies can directly connect has1 function to specific developmental processes relevant to human disease

By leveraging these advantages, researchers can establish causal links between has1 dysfunction and specific developmental abnormalities that may parallel human congenital disorders involving extracellular matrix defects.

What are the latest techniques for examining has1 regulation and interaction networks?

Recent methodological advances have expanded options for investigating has1 regulation and interaction networks:

  • Single-cell RNA sequencing (scRNA-seq):

    • Enables high-resolution analysis of has1 expression in specific cell populations during development

    • Can reveal temporal and spatial regulation patterns not detectable in bulk tissue analysis

    • Particularly valuable for identifying cell type-specific has1 expression patterns

  • ChIP-seq and ATAC-seq:

    • For identifying transcription factors and regulatory elements controlling has1 expression

    • Can reveal developmental stage-specific regulatory mechanisms

  • Proximity labeling approaches (BioID/TurboID):

    • For identifying protein interaction partners of has1 in living cells

    • Can be performed in Xenopus embryos to capture developmental context-specific interactions

  • CRISPR interference/activation:

    • For modulating has1 expression without altering the genomic sequence

    • Allows temporal control over has1 expression when using inducible systems

  • Intravital imaging:

    • For visualizing dynamic changes in extracellular matrix deposition and remodeling

    • Can be combined with fluorescently tagged has1 to track protein localization in living embryos

These technologies, when applied to Xenopus tropicalis has1 research, provide unprecedented insights into the regulatory mechanisms and functional interactions that govern hyaluronan synthesis during development.

How do sex differences affect has1 expression and function in Xenopus tropicalis models?

Sex-specific differences in has1 expression and function represent an important but often overlooked aspect of Xenopus tropicalis research:

  • Expression patterns:

    • Northern blot analyses have shown differential expression of hyaluronan synthases in various adult tissues, which may be influenced by sex-specific factors

    • Sex-specific expression differences should be considered when designing experiments, particularly those involving adult tissues

  • Experimental design considerations:

    • Recent literature emphasizes the importance of accounting for sex differences in Xenopus models of human disease

    • Researchers should consider sex as a biological variable in experimental design, analysis, and interpretation

  • Developmental timing:

    • Sex determination in Xenopus tropicalis occurs during metamorphosis

    • Early embryonic and larval studies typically precede sex differentiation, but late larval and post-metamorphic studies should account for potential sex differences

  • Hormonal influences:

    • Sex hormones may influence has1 expression and the composition of extracellular matrix

    • These effects may be particularly relevant in studies of adult tissues or late developmental stages

Understanding sex-specific aspects of has1 biology is essential for translational research aiming to model human conditions where sex differences in prevalence or presentation exist.

What are common technical challenges when working with recombinant Xenopus tropicalis has1?

Researchers working with recombinant Xenopus tropicalis has1 frequently encounter several technical challenges:

  • Protein solubility and membrane integration:

    • Has1 is a multi-pass transmembrane protein, making it challenging to express in soluble form

    • Solution: Consider using detergent solubilization methods or membrane fraction isolation

    • Alternative: Express only soluble domains for specific applications

  • Enzymatic activity preservation:

    • The catalytic activity of has1 depends on proper folding and post-translational modifications

    • Challenge: Bacterial expression systems may not provide appropriate post-translational modifications

    • Solution: Consider eukaryotic expression systems for functional studies

  • Specificity of antibody detection:

    • Commercial antibodies may cross-react with other hyaluronan synthase family members

    • Solution: Validate antibody specificity using knockdown/knockout controls

    • Alternative: Utilize tagged recombinant versions and detect via tag-specific antibodies

  • Quantification of enzymatic products:

    • Hyaluronan is a heterogeneous, high molecular weight product

    • Challenge: Standard protein quantification methods may not be suitable

    • Solution: Use specialized glycosaminoglycan quantification methods and size determination techniques

Addressing these technical challenges requires careful experimental design and selection of appropriate methodologies based on the specific research question being addressed.

How can researchers optimize CRISPR/Cas9 approaches for studying has1 in Xenopus tropicalis?

CRISPR/Cas9 gene editing in Xenopus tropicalis requires specific optimizations for successful has1 manipulation:

  • Guide RNA design considerations:

    • Target conserved exons that encode functionally critical regions

    • Verify lack of off-target sites in the X. tropicalis genome

    • Consider potential alternative splicing that might bypass targeted exons

  • Delivery methods:

    • Microinjection at the one-cell stage ensures uniform distribution

    • Injection timing: ≤20 minutes post-fertilization is optimal for complete editing

    • Typical injection volumes: 2-4 nl of CRISPR components per embryo

  • Verification of editing efficiency:

    • Design PCR primers flanking the target site for amplification and sequencing

    • Consider T7 endonuclease assay or heteroduplex mobility assay for quick screening

    • For precise insertions/deletions, use deep sequencing approaches

  • Addressing mosaicism:

    • Challenge: F0 CRISPR-edited frogs often exhibit mosaicism

    • Solution: Raise F0 animals to sexual maturity and breed to establish stable lines

    • Alternative: Use high concentrations of Cas9/gRNA for near-complete F0 editing

  • Phenotypic analysis timing:

    • Consider the developmental expression pattern of has1

    • Design phenotypic analyses to coincide with key developmental processes involving hyaluronan

The diploid nature of Xenopus tropicalis makes it particularly amenable to CRISPR/Cas9 approaches compared to the allotetraploid Xenopus laevis, providing a significant advantage for genetic manipulation studies .

What controls are essential when conducting loss-of-function studies of has1?

Rigorous control strategies are essential for reliable interpretation of has1 loss-of-function studies:

  • Genetic controls:

    • Include wild-type siblings from the same clutch of eggs

    • For CRISPR studies: use non-targeting gRNA controls

    • For morpholino studies: standard control morpholinos and rescue experiments

  • Specificity controls:

    • Rescue experiments using has1 mRNA resistant to the knockdown/knockout strategy

    • Multiple independent targeting approaches (different CRISPR guide RNAs or morpholinos)

    • Titration experiments to establish dose-response relationships

  • Functional validation:

    • Direct measurement of hyaluronan levels to confirm functional consequence

    • histochemical detection of hyaluronan using biotinylated hyaluronan-binding protein

    • Analysis of hyaluronan-dependent processes as functional readouts

  • Gene compensation assessment:

    • Measure expression of other hyaluronan synthase family members (has2, has3)

    • Assess potential compensatory upregulation in response to has1 depletion

    • Consider double or triple knockdown/knockout strategies if compensation is detected

These control strategies ensure that observed phenotypes can be confidently attributed to specific has1 loss-of-function rather than off-target effects or experimental artifacts.

How might single-cell technologies advance our understanding of has1 in development?

Single-cell technologies offer transformative opportunities for has1 research in developmental contexts:

  • Single-cell transcriptomics:

    • Can reveal previously undetected cell populations expressing has1

    • Enables tracking of dynamic expression changes during developmental transitions

    • Facilitates identification of co-regulated gene networks

  • Spatial transcriptomics:

    • Combines single-cell resolution with spatial information

    • Can map has1 expression to specific anatomical coordinates in developing embryos

    • Particularly valuable for understanding region-specific functions in complex tissues

  • Single-cell multi-omics:

    • Integration of transcriptomic, epigenomic, and proteomic data at single-cell resolution

    • Can reveal regulatory mechanisms controlling has1 expression

    • Helps establish cause-effect relationships in developmental cascades

  • Lineage tracing combined with single-cell analysis:

    • Can track the developmental trajectory of has1-expressing cells

    • Valuable for understanding the contribution of has1 to specific developmental lineages

These approaches, when applied to Xenopus tropicalis models, can provide unprecedented insights into the spatial and temporal dynamics of has1 function during development.

What are the translational implications of Xenopus tropicalis has1 research for human therapeutics?

Xenopus tropicalis has1 research has several potential translational implications:

  • Developmental disorder insights:

    • Understanding has1 function in Xenopus can inform therapeutic approaches for human disorders involving hyaluronan dysregulation

    • Particularly relevant for congenital disorders affecting craniofacial development, heart formation, and neural development

  • Drug discovery applications:

    • Xenopus embryos can be used for small molecule screening to identify compounds that modulate has1 activity

    • High-throughput screening approaches can leverage the rapid development and external fertilization of Xenopus

  • Regenerative medicine:

    • Insights into has1 function in Xenopus wound healing and regeneration

    • Potential applications in tissue engineering approaches utilizing hyaluronan-based scaffolds

  • Precision medicine approaches:

    • Xenopus models can be used to functionally validate human HAS1 variants of uncertain significance

    • Patient-specific variants can be introduced into Xenopus has1 to assess functional consequences

The conservation of hyaluronan biology between amphibians and humans provides a strong foundation for translational research, while the experimental advantages of Xenopus systems enable rapid testing of therapeutic hypotheses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.