Amino Acid Sequence: Comprises 251 residues (partial sequence: MQTLEEHCWSCSCTRGRDKKGTRLSTWLAQRAAKAMSSLNSLLSLAYHTLASSEGRSLIR...THSD) .
Structural Motifs:
Recombinant insig1 is synthesized using heterologous expression systems:
Cell-Free Synthesis: Offers high yield and flexibility in tag incorporation .
E. coli: Cost-effective for bulk production but lacks post-translational modifications .
Mammalian Systems: Preserves native folding and functional motifs .
SCAP Retention: Binds SCAP-SREBP complexes in the ER, blocking proteolytic activation of SREBPs and reducing cholesterol synthesis .
HMGCR Degradation: Recruits E3 ubiquitin ligases (e.g., AMFR/gp78) to mediate sterol-dependent ER-associated degradation (ERAD) .
In Vivo Impact: Overexpression in transgenic mice reduces hepatic cholesterol by 30% and suppresses fatty acid synthesis .
Recombinant insig1 orthologs exhibit conserved functions but differ in structural nuances:
Xenopus tropicalis INSIG1 is a six-transmembrane protein with both N and C termini facing the cytosol, structurally similar to mammalian INSIG1 proteins. The protein contains key functional domains including the sterol-sensing domain and regions that interact with E3 ubiquitin ligases such as TRC8 (also known as RNF139) . When expressing recombinant X. tropicalis INSIG1, researchers should account for these transmembrane domains which may affect protein folding and solubility during purification processes.
INSIG1 in X. tropicalis, like its mammalian counterparts, functions primarily as a regulator of cholesterol metabolism by mediating the activation of sterol regulatory element-binding protein (SREBP) and facilitating the degradation of HMG-CoA reductase (HMGCR) . Additionally, INSIG1 may play roles in protein degradation pathways involving E3 ubiquitin ligases. Research methodologies for studying these functions include:
Gene expression analysis in different developmental stages
Co-immunoprecipitation studies to identify binding partners
Subcellular localization using tagged recombinant proteins
Functional assays measuring cholesterol metabolism in Xenopus embryos or cell lines
For successful expression of recombinant X. tropicalis INSIG1, researchers should consider the following methodological approaches:
| Expression System | Advantages | Limitations | Optimal Conditions |
|---|---|---|---|
| E. coli | Cost-effective, high yield | Challenging for membrane proteins, lack of post-translational modifications | Use specialized strains (e.g., C41/C43), fusion tags (MBP, SUMO), low temperature induction (16-18°C) |
| Baculovirus/Insect cells | Better for membrane proteins, proper folding | More complex, longer production time | Sf9 or High Five cells, 27-28°C, harvest 48-72h post-infection |
| Mammalian cells | Native-like post-translational modifications | Lower yield, higher cost | HEK293 or CHO cells, transient or stable expression |
| Cell-free systems | Rapid, avoids toxicity issues | Lower yield for membrane proteins | Supplementation with lipids or detergents |
When expressing membrane proteins like INSIG1, addition of detergents such as DDM, LDAO, or CHAPS during purification is critical for maintaining protein stability and function.
A multi-step purification protocol is recommended:
Affinity chromatography using His, FLAG, or GST tags as the initial capture step
Size exclusion chromatography to separate monomeric from aggregated protein
Ion exchange chromatography for removing contaminants with different charge properties
For membrane proteins like INSIG1, consider these critical factors:
Maintain appropriate detergent concentration above CMC throughout purification
Verify protein folding using circular dichroism or fluorescence-based thermal shift assays
Assess functional activity through binding assays with known partners (SCAP, HMGCR)
Validate protein homogeneity through dynamic light scattering or analytical ultracentrifugation
When conducting comparative studies between X. tropicalis INSIG1 and mammalian orthologs, researchers should employ:
Sequence alignment tools (MUSCLE, CLUSTAL) to identify conserved domains
Homology modeling to predict structural similarities and differences
Functional complementation assays in mammalian cells to test conservation of activity
Domain-swapping experiments to identify species-specific functional regions
Key differences may exist in regulatory domains and protein-protein interaction interfaces that should be characterized through targeted mutagenesis and interaction studies.
To experimentally determine functional conservation, implement:
CRISPR/Cas9-mediated knockout of endogenous INSIG1 in X. tropicalis embryos followed by phenotypic analysis
Rescue experiments using mammalian INSIG1 in X. tropicalis knockouts
Biochemical assays comparing substrate specificity and binding partners
Transgenic approaches utilizing X. tropicalis, which is advantageous due to its diploid genome and shorter generation time compared to X. laevis
The transgenic methodologies developed for X. tropicalis provide an excellent platform for these comparative studies, as assays and molecular probes developed in X. laevis can be readily adapted .
Based on findings in mammalian systems, INSIG1 coordinates with E3 ubiquitin ligases such as TRC8 to mediate protein degradation . To study these pathways in X. tropicalis:
Generate fluorescently tagged INSIG1 constructs to monitor localization and trafficking
Perform co-immunoprecipitation with potential X. tropicalis E3 ligases (e.g., TRC8 homolog)
Use ubiquitination assays with recombinant proteins to reconstitute the degradation system in vitro
Employ proteasome and lysosome inhibitors to distinguish between degradation pathways
Develop X. tropicalis cell lines with inducible INSIG1 expression to study dynamic protein interactions
These approaches can reveal whether X. tropicalis INSIG1 participates in protein degradation mechanisms similar to those observed in mammalian systems, where INSIG1-TRC8 complexes mediate lysosomal degradation pathways .
For studying membrane protein interactions:
Microscale thermophoresis (MST) for quantitative binding analysis in detergent solutions
Förster resonance energy transfer (FRET) using fluorescently labeled proteins to detect interactions in native membrane environments
Surface plasmon resonance (SPR) with reconstituted proteoliposomes
Bimolecular fluorescence complementation (BiFC) in X. tropicalis cells or embryos
Chemical crosslinking followed by mass spectrometry (XL-MS) to identify interaction interfaces
When designing these experiments, consider using the genomic resources and transgenic capabilities of X. tropicalis to create reporter systems for real-time monitoring of protein interactions .
To investigate developmental roles of INSIG1:
Perform stage-specific expression analysis using quantitative PCR and in situ hybridization
Generate conditional knockouts using tissue-specific promoters and the GAL4/UAS system adapted for X. tropicalis
Employ transgenic reporters to monitor SREBP pathway activity throughout development
Analyze lipid composition changes in INSIG1-deficient embryos using lipidomics approaches
Perform rescue experiments with structure-specific mutations to identify critical functional domains
These approaches leverage the advantages of X. tropicalis as a model system, including its diploid genome, which simplifies genetic analysis compared to the pseudotetraploid X. laevis .
To explore novel functions:
Perform unbiased protein interactome studies using BioID or proximity labeling approaches
Conduct RNA-seq on INSIG1 knockout embryos to identify affected pathways
Employ metabolomics to detect broader metabolic changes beyond sterols
Use pharmacological perturbations combined with INSIG1 modulation to identify synthetic interactions
Perform genome-wide CRISPR screens in X. tropicalis cells to identify genetic interactions
These comprehensive approaches can reveal unexpected functions of INSIG1 in development or cellular physiology beyond its established role in sterol metabolism.
Membrane proteins like INSIG1 present unique challenges for antibody generation:
Select antigenic regions based on hydrophilicity plots and surface accessibility predictions
Consider using multiple peptide antigens from different regions of the protein
Express and purify soluble fragments (e.g., cytoplasmic domains) for immunization
Validate antibody specificity using knockout controls and recombinant protein standards
Consider developing nanobodies if conventional antibodies prove difficult to generate
For X. tropicalis-specific antibodies, careful sequence comparison with X. laevis is essential to ensure specificity when working in mixed Xenopus research environments.
To characterize post-translational modifications:
Use phospho-specific antibodies combined with phosphatase treatments to identify phosphorylation sites
Employ ubiquitination assays with lysine mutants to map ubiquitination sites
Perform glycosylation analysis using PNGase F and endoglycosidase H treatments
Use mass spectrometry with enrichment strategies for specific modifications
Develop transgenic X. tropicalis lines expressing tagged INSIG1 for in vivo modification studies
These approaches should be combined with functional assays to determine the physiological relevance of identified modifications.
For optimal CRISPR/Cas9 editing of INSIG1 in X. tropicalis:
Design multiple sgRNAs targeting early exons or critical functional domains
Optimize microinjection parameters for X. tropicalis embryos (typically smaller than X. laevis)
Use T7 endonuclease assays or high-resolution melt analysis to screen for mutations
Implement gynogenesis techniques to accelerate homozygous mutant generation
Consider HDR templates for precise mutations or reporter knock-ins
X. tropicalis offers advantages for genetic manipulation due to its diploid genome and shorter generation time, making it ideal for multigenerational genetic studies .
For comprehensive bioinformatic analysis:
Employ comparative genomics across vertebrate species to identify conserved regulatory elements
Use ChIP-seq data analysis to identify transcription factors regulating INSIG1 expression
Implement protein-protein interaction network prediction using interologous mapping
Apply molecular dynamics simulations to predict structural impacts of mutations
Perform pathway enrichment analysis with available X. tropicalis transcriptomic datasets
These computational approaches should be validated experimentally using the transgenic and genomic resources available for X. tropicalis .