Recombinant Xenopus tropicalis Insulin-induced gene 1 protein (insig1)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Details

  • Gene Name: insig1 (Xenopus tropicalis) .

  • Synonyms: CL6, CL-6 .

  • UniProt ID: Q0V9G6 .

  • Amino Acid Sequence: Comprises 251 residues (partial sequence: MQTLEEHCWSCSCTRGRDKKGTRLSTWLAQRAAKAMSSLNSLLSLAYHTLASSEGRSLIR...THSD) .

  • Structural Motifs:

    • Six transmembrane helices with cytosolic N- and C-termini .

    • Sterol-sensing domain (SSD) for binding SCAP and HMGCR .

    • KH motif (C-terminal) for COPI-mediated ER retrieval .

Recombinant Variants

PropertySpecification
Host SystemCell-free expression, E. coli, or mammalian cells .
Purity≥85% (SDS-PAGE verified) .
TagHis tag, Strep tag, or untagged (varies by production method) .
Storage-20°C in Tris buffer with 50% glycerol; avoid freeze-thaw cycles .

Production Methods

Recombinant insig1 is synthesized using heterologous expression systems:

  • Cell-Free Synthesis: Offers high yield and flexibility in tag incorporation .

  • E. coli: Cost-effective for bulk production but lacks post-translational modifications .

  • Mammalian Systems: Preserves native folding and functional motifs .

Role in Cholesterol and Lipid Metabolism

  • SCAP Retention: Binds SCAP-SREBP complexes in the ER, blocking proteolytic activation of SREBPs and reducing cholesterol synthesis .

  • HMGCR Degradation: Recruits E3 ubiquitin ligases (e.g., AMFR/gp78) to mediate sterol-dependent ER-associated degradation (ERAD) .

  • In Vivo Impact: Overexpression in transgenic mice reduces hepatic cholesterol by 30% and suppresses fatty acid synthesis .

Disease-Related Applications

Study FocusKey FindingSource
HIV-1 InhibitionReduces HIV-1 virion yield by degrading Gag protein via TRC8-mediated ERAD
GlucolipotoxicityProtects pancreatic β-cells by downregulating SREBP-1c under high glucose
Aquatic ModelsRegulates LC-PUFA biosynthesis in teleosts via miR-33/insig1 interplay

Comparative Analysis Across Species

Recombinant insig1 orthologs exhibit conserved functions but differ in structural nuances:

SpeciesKey Differences
Human (INSIG1)Two translational start sites (37-kDa and 35-kDa isoforms) .
Mouse (Insig1)Single isoform due to truncated N-terminus .
Xenopus tropicalisShares 68% sequence identity with human INSIG1; used for evolutionary studies .

Future Research Directions

  • Mechanistic Studies: Elucidate interactions with viral proteins (e.g., HIV-1 Gag) .

  • Therapeutic Potential: Explore insig1 agonists for metabolic disorders like hypercholesterolemia .

  • Transgenic Models: Develop Xenopus tropicalis lines to study insig1 in development .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
insig1; Insulin-induced gene 1 protein; INSIG-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
insig1
Target Protein Sequence
MQTLEEHCWSCSCTRGRDKKGTRLSTWLAQRAAKAMSSLNSLLSLAYHTLASSEGRSLIR RSLVLFAVGVFLALVLNLLQIQRNVTLFPEEVIATIFSSAWWVPPCCGTAAAVVGLLYPC IDSHLGEPHKFKREWASVMRCIAVFVGINHASAKLDFANNVQLSLTLAALSLGLWWTFDR SRSGLGLGITIAFLATLITQFLVYNGVYQYTSPDFLYIRSWLPCIFFSGGVTVGNIGRQL AMGSSEKTHSD
Uniprot No.

Target Background

Function
INSIG1 is an oxysterol-binding protein that regulates cholesterol biosynthesis through feedback control. It mediates endoplasmic reticulum (ER) to Golgi transport of Scap and HMGCR degradation. INSIG1 acts as a negative regulator by retaining the SCAP-SREBP complex in the ER, thereby inhibiting the processing of sterol regulatory element-binding proteins (SREBPs). Oxysterol binding, including 25-hydroxycholesterol, modulates INSIG1's interaction with Scap and ER retention of the SCAP-SREBP complex. In the presence of oxysterols, INSIG1 interacts with Scap, preventing SREBP transport to the Golgi. Sterol deprivation reduces oxysterol binding, disrupting the INSIG1-Scap interaction, facilitating Golgi transport of the SCAP-SREBP complex, subsequent SREBP processing, and nuclear translocation. INSIG1 also regulates cholesterol synthesis by modulating HMGCR degradation.
Database Links
Protein Families
INSIG family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Xenopus tropicalis INSIG1 protein?

Xenopus tropicalis INSIG1 is a six-transmembrane protein with both N and C termini facing the cytosol, structurally similar to mammalian INSIG1 proteins. The protein contains key functional domains including the sterol-sensing domain and regions that interact with E3 ubiquitin ligases such as TRC8 (also known as RNF139) . When expressing recombinant X. tropicalis INSIG1, researchers should account for these transmembrane domains which may affect protein folding and solubility during purification processes.

What are the fundamental functions of INSIG1 in Xenopus tropicalis?

INSIG1 in X. tropicalis, like its mammalian counterparts, functions primarily as a regulator of cholesterol metabolism by mediating the activation of sterol regulatory element-binding protein (SREBP) and facilitating the degradation of HMG-CoA reductase (HMGCR) . Additionally, INSIG1 may play roles in protein degradation pathways involving E3 ubiquitin ligases. Research methodologies for studying these functions include:

  • Gene expression analysis in different developmental stages

  • Co-immunoprecipitation studies to identify binding partners

  • Subcellular localization using tagged recombinant proteins

  • Functional assays measuring cholesterol metabolism in Xenopus embryos or cell lines

What expression systems are most effective for producing recombinant X. tropicalis INSIG1?

For successful expression of recombinant X. tropicalis INSIG1, researchers should consider the following methodological approaches:

Expression SystemAdvantagesLimitationsOptimal Conditions
E. coliCost-effective, high yieldChallenging for membrane proteins, lack of post-translational modificationsUse specialized strains (e.g., C41/C43), fusion tags (MBP, SUMO), low temperature induction (16-18°C)
Baculovirus/Insect cellsBetter for membrane proteins, proper foldingMore complex, longer production timeSf9 or High Five cells, 27-28°C, harvest 48-72h post-infection
Mammalian cellsNative-like post-translational modificationsLower yield, higher costHEK293 or CHO cells, transient or stable expression
Cell-free systemsRapid, avoids toxicity issuesLower yield for membrane proteinsSupplementation with lipids or detergents

When expressing membrane proteins like INSIG1, addition of detergents such as DDM, LDAO, or CHAPS during purification is critical for maintaining protein stability and function.

What purification strategies yield highest purity and activity for X. tropicalis INSIG1?

A multi-step purification protocol is recommended:

  • Affinity chromatography using His, FLAG, or GST tags as the initial capture step

  • Size exclusion chromatography to separate monomeric from aggregated protein

  • Ion exchange chromatography for removing contaminants with different charge properties

For membrane proteins like INSIG1, consider these critical factors:

  • Maintain appropriate detergent concentration above CMC throughout purification

  • Verify protein folding using circular dichroism or fluorescence-based thermal shift assays

  • Assess functional activity through binding assays with known partners (SCAP, HMGCR)

  • Validate protein homogeneity through dynamic light scattering or analytical ultracentrifugation

How does X. tropicalis INSIG1 compare structurally and functionally to mammalian orthologs?

When conducting comparative studies between X. tropicalis INSIG1 and mammalian orthologs, researchers should employ:

  • Sequence alignment tools (MUSCLE, CLUSTAL) to identify conserved domains

  • Homology modeling to predict structural similarities and differences

  • Functional complementation assays in mammalian cells to test conservation of activity

  • Domain-swapping experiments to identify species-specific functional regions

Key differences may exist in regulatory domains and protein-protein interaction interfaces that should be characterized through targeted mutagenesis and interaction studies.

What experimental approaches can determine if functional mechanisms of INSIG1 are conserved between X. tropicalis and mammals?

To experimentally determine functional conservation, implement:

  • CRISPR/Cas9-mediated knockout of endogenous INSIG1 in X. tropicalis embryos followed by phenotypic analysis

  • Rescue experiments using mammalian INSIG1 in X. tropicalis knockouts

  • Biochemical assays comparing substrate specificity and binding partners

  • Transgenic approaches utilizing X. tropicalis, which is advantageous due to its diploid genome and shorter generation time compared to X. laevis

The transgenic methodologies developed for X. tropicalis provide an excellent platform for these comparative studies, as assays and molecular probes developed in X. laevis can be readily adapted .

How can recombinant X. tropicalis INSIG1 be used to study protein degradation pathways?

Based on findings in mammalian systems, INSIG1 coordinates with E3 ubiquitin ligases such as TRC8 to mediate protein degradation . To study these pathways in X. tropicalis:

  • Generate fluorescently tagged INSIG1 constructs to monitor localization and trafficking

  • Perform co-immunoprecipitation with potential X. tropicalis E3 ligases (e.g., TRC8 homolog)

  • Use ubiquitination assays with recombinant proteins to reconstitute the degradation system in vitro

  • Employ proteasome and lysosome inhibitors to distinguish between degradation pathways

  • Develop X. tropicalis cell lines with inducible INSIG1 expression to study dynamic protein interactions

These approaches can reveal whether X. tropicalis INSIG1 participates in protein degradation mechanisms similar to those observed in mammalian systems, where INSIG1-TRC8 complexes mediate lysosomal degradation pathways .

What techniques can be used to study INSIG1 interaction with membrane-bound partners in X. tropicalis?

For studying membrane protein interactions:

  • Microscale thermophoresis (MST) for quantitative binding analysis in detergent solutions

  • Förster resonance energy transfer (FRET) using fluorescently labeled proteins to detect interactions in native membrane environments

  • Surface plasmon resonance (SPR) with reconstituted proteoliposomes

  • Bimolecular fluorescence complementation (BiFC) in X. tropicalis cells or embryos

  • Chemical crosslinking followed by mass spectrometry (XL-MS) to identify interaction interfaces

When designing these experiments, consider using the genomic resources and transgenic capabilities of X. tropicalis to create reporter systems for real-time monitoring of protein interactions .

How can X. tropicalis INSIG1 be utilized to study developmental regulation of cholesterol metabolism?

To investigate developmental roles of INSIG1:

  • Perform stage-specific expression analysis using quantitative PCR and in situ hybridization

  • Generate conditional knockouts using tissue-specific promoters and the GAL4/UAS system adapted for X. tropicalis

  • Employ transgenic reporters to monitor SREBP pathway activity throughout development

  • Analyze lipid composition changes in INSIG1-deficient embryos using lipidomics approaches

  • Perform rescue experiments with structure-specific mutations to identify critical functional domains

These approaches leverage the advantages of X. tropicalis as a model system, including its diploid genome, which simplifies genetic analysis compared to the pseudotetraploid X. laevis .

What experimental approaches can determine if X. tropicalis INSIG1 has functions beyond cholesterol regulation?

To explore novel functions:

  • Perform unbiased protein interactome studies using BioID or proximity labeling approaches

  • Conduct RNA-seq on INSIG1 knockout embryos to identify affected pathways

  • Employ metabolomics to detect broader metabolic changes beyond sterols

  • Use pharmacological perturbations combined with INSIG1 modulation to identify synthetic interactions

  • Perform genome-wide CRISPR screens in X. tropicalis cells to identify genetic interactions

These comprehensive approaches can reveal unexpected functions of INSIG1 in development or cellular physiology beyond its established role in sterol metabolism.

How can researchers overcome challenges in generating antibodies against X. tropicalis INSIG1?

Membrane proteins like INSIG1 present unique challenges for antibody generation:

  • Select antigenic regions based on hydrophilicity plots and surface accessibility predictions

  • Consider using multiple peptide antigens from different regions of the protein

  • Express and purify soluble fragments (e.g., cytoplasmic domains) for immunization

  • Validate antibody specificity using knockout controls and recombinant protein standards

  • Consider developing nanobodies if conventional antibodies prove difficult to generate

For X. tropicalis-specific antibodies, careful sequence comparison with X. laevis is essential to ensure specificity when working in mixed Xenopus research environments.

What are the most effective approaches to studying INSIG1 post-translational modifications in X. tropicalis?

To characterize post-translational modifications:

  • Use phospho-specific antibodies combined with phosphatase treatments to identify phosphorylation sites

  • Employ ubiquitination assays with lysine mutants to map ubiquitination sites

  • Perform glycosylation analysis using PNGase F and endoglycosidase H treatments

  • Use mass spectrometry with enrichment strategies for specific modifications

  • Develop transgenic X. tropicalis lines expressing tagged INSIG1 for in vivo modification studies

These approaches should be combined with functional assays to determine the physiological relevance of identified modifications.

How can CRISPR/Cas9 technology be optimized for X. tropicalis INSIG1 functional studies?

For optimal CRISPR/Cas9 editing of INSIG1 in X. tropicalis:

  • Design multiple sgRNAs targeting early exons or critical functional domains

  • Optimize microinjection parameters for X. tropicalis embryos (typically smaller than X. laevis)

  • Use T7 endonuclease assays or high-resolution melt analysis to screen for mutations

  • Implement gynogenesis techniques to accelerate homozygous mutant generation

  • Consider HDR templates for precise mutations or reporter knock-ins

X. tropicalis offers advantages for genetic manipulation due to its diploid genome and shorter generation time, making it ideal for multigenerational genetic studies .

What bioinformatic approaches are most valuable for predicting X. tropicalis INSIG1 function and regulatory networks?

For comprehensive bioinformatic analysis:

  • Employ comparative genomics across vertebrate species to identify conserved regulatory elements

  • Use ChIP-seq data analysis to identify transcription factors regulating INSIG1 expression

  • Implement protein-protein interaction network prediction using interologous mapping

  • Apply molecular dynamics simulations to predict structural impacts of mutations

  • Perform pathway enrichment analysis with available X. tropicalis transcriptomic datasets

These computational approaches should be validated experimentally using the transgenic and genomic resources available for X. tropicalis .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.