Recombinant Xenopus tropicalis Kidney mitochondrial carrier protein 1 (slc25a30)

Shipped with Ice Packs
In Stock

Description

Protein Overview

slc25a30, also known as Kidney mitochondrial carrier protein 1 (KMCP1), is a 291-amino-acid protein encoded by the slc25a30 gene in Xenopus tropicalis. Its recombinant form is expressed in E. coli with an N-terminal His tag for purification .

ParameterDetails
UniProt IDQ5XGI1
Molecular Weight~32 kDa (theoretical)
Protein LengthFull-length (1-291 aa)
TagHis-tag
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Biological Role

slc25a30 functions as an antiporter that primarily transports inorganic anions such as sulfate, sulfite, thiosulfate, and phosphate, with secondary activity toward dicarboxylates . It localizes to the inner mitochondrial membrane and plays a role in metabolic homeostasis.

Key Features

  • Substrate Specificity: Prefers sulfate and phosphate over dicarboxylates like malate or succinate .

  • Mechanism: Utilizes a "single binding site-gating pore" structure common to SLC25 family members .

  • Conservation: Shares synteny with mammalian mitochondrial carriers, making it a model for studying human homologs .

Experimental Use

  • Transport Assays: Used to study anion exchange kinetics in mitochondrial membranes .

  • Structural Studies: Serves as a template for cryo-EM or X-ray crystallography to resolve transporter mechanisms .

  • Disease Modeling: Linked to metabolic disorders due to its role in sulfate/phosphate homeostasis .

Technical Notes

  • Reconstitution: Requires dilution to 0.1–1.0 mg/mL in deionized water, with glycerol (5–50%) for stability .

  • Storage: Stable at -80°C for long-term storage; avoid repeated freeze-thaw cycles .

Biological Relevance in Xenopus tropicalis

Xenopus tropicalis is a key model for genetic studies due to its diploid genome and conserved gene functions with mammals . The slc25a30 gene is expressed in the kidney, aligning with its role in ion transport and metabolic regulation . Mutations in homologous SLC25 genes are associated with human diseases, underscoring its translational relevance .

Future Directions

  • Functional Genomics: Leverage CRISPR/Cas9 in X. tropicalis to study slc25a30 knockout phenotypes .

  • Therapeutic Screening: Target slc25a30 in drug development for mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please specify them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributors.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc25a30; kmcp1; TGas086a12.1; Kidney mitochondrial carrier protein 1; Solute carrier family 25 member 30
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
slc25a30
Target Protein Sequence
MTALNWKPFIYGGLASITAECGTFPIDLTKTRLQVQGQANDAKYKEIRYRGMLHAIVRIW KEEGVKALYSGIAPAMLRQASYGTIKIGTYQSLKRLFVDCPEDETLVINVFCGVLSGVVS SCIANPTDVLKIRMQAQGSLIQGGMIGNFINIYQQEGTRGLWKGVSLTAQRAAIVVGVEL PVYDITKKHLILSGLMGDTVYTHFLASFTCGLAGALASNPVDVVRTRMMNQRSIRNVSNS SYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFITYEQLKKLNL
Uniprot No.

Target Background

Function
Probable transporter.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is SLC25A30 and what is its role in Xenopus tropicalis?

SLC25A30, also known as Kidney Mitochondrial Carrier Protein 1 (KMCP1), belongs to the solute carrier family 25 group of proteins. In Xenopus tropicalis, this protein consists of 291 amino acids and is believed to function as a mitochondrial carrier protein involved in molecular transport processes . The full-length protein contains specific functional domains characteristic of mitochondrial carrier proteins that facilitate the movement of substrates across the inner mitochondrial membrane. The protein plays roles in cellular metabolism, though specific pathways are still being elucidated through ongoing research.

How should recombinant SLC25A30 protein be stored and handled?

Recombinant SLC25A30 is typically supplied as a lyophilized powder that requires proper storage and reconstitution. For optimal stability, store the lyophilized protein at -20°C/-80°C upon receipt . When working with the protein, reconstitute it in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL. To prevent protein degradation, it's advisable to add glycerol to a final concentration of 50% for long-term storage .

Once reconstituted, avoid repeated freeze-thaw cycles as these can significantly reduce protein activity. For working aliquots, store at 4°C for up to one week . The protein is typically supplied in a Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain stability during storage .

What expression systems are used to produce recombinant Xenopus tropicalis SLC25A30?

The most common expression system for producing recombinant Xenopus tropicalis SLC25A30 is E. coli . The protein is typically expressed with a His-tag to facilitate purification through affinity chromatography. The full-length protein (1-291 amino acids) can be successfully expressed in this bacterial system, providing sufficient yields for experimental applications .

Other expression systems including mammalian cells (such as HEK293) may also be employed for specific experimental needs, particularly when post-translational modifications are crucial . The choice of expression system should be determined by the specific research questions being addressed, as each system offers different advantages regarding protein folding, post-translational modifications, and expression yields.

How can I use Xenopus tropicalis SLC25A30 in developmental biology studies?

Xenopus tropicalis has emerged as a powerful model system for developmental biology, combining genetic and genomic analysis capabilities with robust embryological techniques . To study SLC25A30's role in development, consider the following methodological approach:

First, establish a temporal expression profile of SLC25A30 during embryonic development using RT-PCR or in situ hybridization to determine when and where the gene is expressed. For functional studies, design morpholino oligonucleotides targeting SLC25A30 mRNA for knockdown experiments, or implement CRISPR/Cas9 for gene editing.

To assess phenotypic effects, examine kidney development using markers such as lhx1 (lim1), pax8, and wt1. Since Xenopus embryos develop rapidly with a functional kidney forming in approximately 2 days, you can quickly assess how SLC25A30 disruption affects nephrogenesis . For rescue experiments, co-inject the morpholino with capped mRNA encoding the wild-type SLC25A30 to confirm specificity of the observed phenotypes.

What experimental approaches can be used to study SLC25A30 function in Xenopus tropicalis?

To investigate SLC25A30 function in Xenopus tropicalis, multiple complementary approaches can be employed:

  • Genetic manipulation: Utilize CRISPR/Cas9 gene editing to generate SLC25A30 knockout or knock-in models. Alternatively, employ morpholino-mediated knockdown for transient loss-of-function studies .

  • Haploid embryo techniques: Generate haploid embryos using UV-irradiated sperm to fertilize normal eggs. This approach simplifies genetic analysis by exposing recessive phenotypes and can be particularly useful when studying SLC25A30 mutations .

  • Explant cultures: Isolate animal caps or kidney primordia and culture them in the presence of various inductive factors to assess SLC25A30's role in kidney specification and differentiation.

  • Biochemical assays: Using purified recombinant SLC25A30, perform substrate transport assays with liposomes to identify potential molecules transported by this mitochondrial carrier protein.

  • Imaging techniques: Employ fluorescently-tagged SLC25A30 to visualize its subcellular localization and potential interactions with other mitochondrial proteins.

How does SLC25A30 structure relate to its function in mitochondrial transport?

SLC25A30 (KMCP1) belongs to the mitochondrial carrier family of proteins that typically contain three tandemly repeated ~100 amino acid domains. Each domain contains two transmembrane alpha-helices connected by a hydrophilic loop. This structural arrangement forms a channel through which specific substrates can be transported across the inner mitochondrial membrane.

To investigate structure-function relationships, consider using the recombinant protein for:

  • Site-directed mutagenesis: Based on sequence analysis and comparison with better-characterized mitochondrial carriers, identify conserved residues likely involved in substrate binding or transport. The full amino acid sequence provided in search result can serve as the basis for identifying these residues.

  • Substrate binding assays: Using purified recombinant protein, perform binding assays with potential substrates to determine binding affinities and kinetics.

  • Reconstitution in liposomes: Incorporate purified SLC25A30 into liposomes to measure transport of specific substrates in a controlled environment.

  • Structural studies: While challenging, crystallography or cryo-electron microscopy could provide detailed structural information that would illuminate the transport mechanism.

What are the challenges in expressing and purifying functional SLC25A30 for structural studies?

Membrane proteins like SLC25A30 present several challenges for structural studies:

  • Expression system selection: While E. coli is commonly used for expressing Xenopus tropicalis SLC25A30 , membrane proteins often encounter folding issues in bacterial systems. Consider testing expression in eukaryotic systems like insect cells (baculovirus) or yeast to improve proper folding.

  • Detergent optimization: Following expression, identifying the optimal detergent for extraction and purification is crucial. Screen multiple detergents (e.g., DDM, LDAO, C12E8) to find one that maintains protein stability and function.

  • Purification strategy: The His-tagged version described in search result offers a starting point for purification using immobilized metal affinity chromatography (IMAC). Follow with size exclusion chromatography to achieve high purity required for structural studies.

  • Protein stability assessment: Employ thermal shift assays or limited proteolysis to identify conditions that enhance protein stability during purification and crystallization attempts.

  • Lipid requirements: Consider incorporating specific lipids during purification or reconstitution to maintain the native-like environment required for function.

What are the optimal conditions for reconstituting lyophilized SLC25A30?

When working with lyophilized recombinant SLC25A30, follow these steps for optimal reconstitution:

  • Briefly centrifuge the vial containing lyophilized protein to ensure all material is at the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL .

  • For long-term storage, add glycerol to a final concentration of 5-50%, with 50% being recommended by suppliers .

  • Gently mix by pipetting; avoid vortexing which can denature the protein.

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles.

  • For short-term use, store aliquots at 4°C for up to one week. For long-term storage, keep at -20°C or preferably -80°C .

  • Before using in experiments, allow the protein to equilibrate to room temperature and centrifuge briefly to remove any particulates.

How can I establish a Xenopus tropicalis model for studying SLC25A30 function in kidney development?

To establish a Xenopus tropicalis model for studying SLC25A30's role in kidney development:

  • Obtain wild-type Xenopus tropicalis: Source animals from established suppliers or breeding colonies.

  • Generate modified embryos:

    • For transient knockdown, design morpholinos targeting the translation start site or splice junctions of SLC25A30.

    • For stable genetic models, use CRISPR/Cas9 to introduce mutations in the SLC25A30 gene .

  • Haploid embryo generation (optional): Follow the protocol described in search result :

    • Prime female X. tropicalis with 10u HCG, then boost with 100-200u HCG.

    • Collect eggs in 1×MMR to prevent premature activation.

    • UV-irradiate sperm (50,000 microjoules) before fertilization.

    • Culture embryos at 25°C after fertilization .

  • Phenotypic analysis:

    • Examine kidney development using whole-mount in situ hybridization with markers for pronephric tubules.

    • Assess kidney function through dye clearance assays.

    • Perform histological analysis to examine kidney structure at the cellular level.

  • Molecular analysis:

    • Use RT-PCR and Western blotting to confirm SLC25A30 knockdown or mutation.

    • Perform RNA-seq to identify downstream genes affected by SLC25A30 disruption.

What analytical methods can be used to verify the purity and activity of recombinant SLC25A30?

To verify the purity and activity of recombinant SLC25A30:

  • Purity assessment:

    • SDS-PAGE: Run the purified protein on a gel to check for purity; suppliers typically ensure >90% purity .

    • Western blotting: Use anti-His antibodies or specific anti-SLC25A30 antibodies to confirm identity.

    • Mass spectrometry: For precise molecular weight determination and detection of potential post-translational modifications.

  • Functional assays:

    • Liposome reconstitution: Incorporate the protein into liposomes and measure transport of potential substrates.

    • Circular dichroism: Assess secondary structure to confirm proper folding.

    • Thermal shift assays: Evaluate protein stability under different buffer conditions.

  • Activity verification:

    • ATP/ADP exchange assays: If SLC25A30 functions as an ATP/ADP carrier.

    • Membrane potential measurements in proteoliposomes: To assess ion transport capabilities.

    • Substrate binding assays: Using isothermal titration calorimetry or surface plasmon resonance.

How can I use Xenopus tropicalis haploid genetics to study SLC25A30 mutations?

Haploid genetics in Xenopus tropicalis offers a powerful approach for studying SLC25A30 mutations:

  • Generate haploid embryos: Follow the protocol outlined in search result :

    • Prime and boost female X. tropicalis with HCG.

    • UV-irradiate sperm before fertilization to inactivate the genetic material.

    • This results in haploid embryos containing only maternal chromosomes .

  • Mutagenesis approaches:

    • Chemical mutagenesis: Treat females with ethylnitrosourea (ENU) prior to egg collection.

    • CRISPR/Cas9: Inject Cas9 protein and SLC25A30-targeting sgRNAs into unfertilized eggs prior to haploid induction.

  • Screening for mutations:

    • Design a high-throughput screening strategy based on kidney phenotypes.

    • Use targeted sequencing to identify SLC25A30 mutations in embryos with kidney abnormalities.

  • Advantage of haploidy: In haploid embryos, recessive mutations are immediately expressed phenotypically, eliminating the need for inbreeding to generate homozygotes .

  • Verification in diploids: Once mutations are identified in haploids, generate heterozygous carriers in diploid embryos through gynogenesis, then produce homozygous mutants by inbreeding.

How can SLC25A30 studies in Xenopus tropicalis inform human kidney disease research?

Xenopus tropicalis provides an excellent model for studying human kidney diseases, with 79% of identified human disease genes having verified orthologs in Xenopus . For SLC25A30 specifically:

  • Comparative analysis: The conservation of SLC25A30 between Xenopus and humans allows for meaningful comparisons. Examining the functional domains and expression patterns can reveal evolutionarily conserved roles relevant to human disease.

  • Kidney development studies: Xenopus embryos develop a functional kidney in approximately 2 days, allowing rapid assessment of how SLC25A30 disruption affects nephrogenesis . This can inform understanding of congenital anomalies of the kidney and urinary tract (CAKUT) in humans.

  • Disease modeling: Using CRISPR/Cas9 to introduce human disease-associated mutations into the Xenopus SLC25A30 gene can create models of specific human disorders. These models can then be used to study disease mechanisms and test potential therapeutic approaches.

  • High-throughput screening: The ease of manipulating Xenopus embryos and the large clutch sizes facilitate screening of potential therapeutic compounds that might restore function in SLC25A30 mutants.

What protocols can be used to assess kidney function in Xenopus tropicalis models with SLC25A30 mutations?

To assess kidney function in Xenopus tropicalis models with SLC25A30 mutations:

  • Dye clearance assays:

    • Inject fluorescent dextran into the circulation and monitor its clearance by the pronephros over time.

    • Take time-lapse images to quantify clearance rates.

  • Edema assessment:

    • Document the presence and severity of edema, a common sign of kidney dysfunction.

    • Measure body dimensions to quantify edema objectively.

  • Histological analysis:

    • Perform histological sectioning and staining to examine kidney structure.

    • Look for abnormalities in tubule formation, glomerular development, and cell morphology.

  • Marker expression:

    • Use in situ hybridization or immunohistochemistry to examine expression of kidney markers (pax8, lhx1, nephrin, podocin).

    • Assess whether specific segments of the nephron are affected by SLC25A30 mutation.

  • Electron microscopy:

    • Examine ultrastructural features of kidney cells, particularly mitochondria (given SLC25A30's role as a mitochondrial carrier protein).

    • Look for abnormalities in podocyte foot processes or tubular brush borders.

What emerging technologies might enhance the study of SLC25A30 in Xenopus tropicalis?

Several emerging technologies show promise for advancing SLC25A30 research in Xenopus tropicalis:

  • Single-cell RNA sequencing: This technology could reveal cell-type specific expression patterns of SLC25A30 within the kidney and other tissues, providing insights into its function in different cellular contexts.

  • Cryo-electron microscopy: As this technology continues to improve, it may become feasible to determine the structure of SLC25A30 at atomic resolution, revealing details of substrate binding and transport mechanisms.

  • Genome editing advancements: Improvements in CRISPR/Cas9 technology, including base editing and prime editing, could enable more precise manipulation of the SLC25A30 gene to introduce specific mutations or tags.

  • Kidney organoids: The development of Xenopus kidney organoids could provide a simplified system for studying SLC25A30 function in a controlled environment .

  • Live imaging techniques: Advanced microscopy techniques combined with fluorescent tags could allow visualization of SLC25A30 dynamics in living embryos, providing insights into its localization and movement during development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.