Recombinant Xenopus tropicalis Low-density lipoprotein receptor class A domain-containing protein 3 (ldlrad3)

Shipped with Ice Packs
In Stock

Description

Introduction and Basic Properties

PropertyDetails
Gene Symbolldlrad3
Full NameLow-density lipoprotein receptor class A domain-containing protein 3
OrganismXenopus tropicalis (tropical clawed frog)
Uniprot IDA4IHY6
Expression Region14–337 amino acids (mature protein)
TagN-terminal 10xHis-tag (in recombinant form)
StorageTris-based buffer, 50% glycerol; store at -20°C/-80°C

Functional Role in Viral Pathogenesis

LDLRAD3 is a key attachment and entry receptor for VEEV, a neurotropic alphavirus. Key findings include:

StudyKey Findings
VEEV BindingBinds VEEV particles via D1, enhancing attachment and internalization .
Species ConservationLDLRAD3 is conserved across mammals, birds, reptiles, amphibians, and fish .
Therapeutic PotentialLdlrad3-D1-Fc fusion proteins block VEEV infection in vitro and in vivo .
Cellular ExpressionExpressed in neurons, epithelial cells, and myeloid cells; absent in T cells and monocytes .

Recombinant Protein Applications

The recombinant X. tropicalis LDLRAD3 is used in research to study VEEV entry mechanisms and develop antiviral therapies.

Production and Purity

  • Expression System: E. coli with N-terminal His-tag for purification .

  • Sequence: Full-length mature protein (14–337 aa) with a calculated molecular weight of ~37 kDa .

Research Utility

  1. Viral Entry Assays: Used to test VEEV attachment/internalization in neuronal cell lines (e.g., N2a, SH-SY5Y) .

  2. Antibody Development: Serves as an antigen for generating neutralizing anti-Ldlrad3 antibodies .

  3. Structural Studies: Cryo-EM reconstructions of VEEV-Ldlrad3 complexes elucidate domain-specific interactions .

Recombinant Xenopus tropicalis LDLRAD3 is a critical tool for understanding VEEV pathogenesis and developing targeted therapies. Its conserved D1 domain enables cross-species viral entry, while its recombinant form facilitates structural and functional studies. Future research may explore its role in other viral or cellular processes, leveraging its conserved structure across evolutionary lineages .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery estimates.
Note: All protein shipments are standardly accompanied by blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for customers.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specified tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
ldlrad3; Low-density lipoprotein receptor class A domain-containing protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
14-337
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ldlrad3
Target Protein Sequence
QLLPGNNHTTECNIPGNFMCSNGRCIPGGWQCDGNPDCFDESDEKECPRARSRCGPNFFPCTSGIHCIIARFQCNGFEDCPDGSDEENCTAHPLLCSNSRFHCKNHLCIDKSFVCDGQNNCLDNSDEEHCHSPQEPGSEQDYVSSENQLLYYPSITYTIIGSSVIFVLVVALLALVLHHQRKRNLMSLPVHRLQHPLLLSRLVVLDHPHHCRVTYNVNNGIQYMSGQGYQQPVSVESPPSYTEAVLDHSSRPPWFDLPPPPYPSDMESVSQTELPPYRSRTGSSASAGSTEHPRGTPCGTESPTEPQDPTAAPSDDLPSTEVDV
Uniprot No.

Target Background

Database Links

KEGG: xtr:100124916

UniGene: Str.53230

Protein Families
LDLR family
Subcellular Location
Cell membrane; Single-pass type I membrane protein.

Q&A

What is LDLRAD3 and what is its role in Xenopus tropicalis?

LDLRAD3 is a member of the low-density lipoprotein receptor (LDLR) family that contains class A domains. In Xenopus tropicalis, as in other vertebrates, LDLRAD3 appears to function primarily as a membrane receptor protein. Recent research has revealed that LDLRAD3, along with other LDLR family members including VLDLR and ApoER2, can act as entry factors for different alphaviruses . The protein contains specific ligand-binding domains that facilitate these interactions. While initially studied for its role in lipoprotein metabolism, its function in viral entry has significantly expanded scientific interest in this protein and its recombinant forms.

How is recombinant Xenopus tropicalis LDLRAD3 protein typically produced?

Recombinant Xenopus tropicalis LDLRAD3 protein can be produced using several expression systems, with yeast being one of the most economical and efficient eukaryotic systems for this purpose. The yeast protein expression system integrates advantages of mammalian cell expression systems while maintaining cost-effectiveness . The recombinant protein typically includes amino acids 14-169 of the native sequence and can be tagged (commonly with His tag) for purification and detection purposes . The expression in yeast allows for post-translational modifications such as glycosylation, acylation, and phosphorylation that ensure the recombinant protein maintains native-like conformation. Alternative expression systems include E. coli, mammalian cells, and baculovirus infection, each with different implications for protein structure, yield, and cost .

What are the advantages of using Xenopus tropicalis as a source organism for LDLRAD3?

Xenopus tropicalis offers several advantages as a source organism for studying LDLRAD3:

  • Diploid genome with high synteny to humans, making it relevant for translational research

  • Relatively short life cycle compared to other vertebrate models

  • Large, externally developing embryos that are easily accessible for manipulation

  • Compatibility with genome editing techniques like CRISPR/Cas9 and TALEN, allowing for efficient genetic modification

  • Strong conservation of key protein domains across species while maintaining species-specific characteristics that can be useful for comparative studies

These advantages make Xenopus tropicalis LDLRAD3 a valuable tool for investigating both basic receptor biology and disease-relevant mechanisms, particularly in the context of viral infections and potential therapeutic interventions .

How does LDLRAD3 compare functionally to other LDLR family members in viral entry mechanisms?

Recent research has expanded our understanding of how different LDLR family members, including LDLRAD3, VLDLR, ApoER2, and LDLR itself, function as entry receptors for alphaviruses. LDLRAD3 was initially identified as a receptor for Venezuelan equine encephalitis virus , while subsequent research has revealed that LDLR can facilitate binding and infection of Eastern equine encephalitis virus (EEEV), Western equine encephalitis virus, and to a lesser extent, Semliki Forest virus .

Functional differences between these receptors include:

  • Domain specificity: LDLR interaction with EEEV occurs predominantly through LA domain 3 (LA3), whereas other family members may utilize different domains

  • Binding affinity: LDLR demonstrates lower affinity interactions with alphavirus particles compared to some other receptors

  • Virus specificity: Different LDLR family members show varying tropism for specific alphaviruses

  • Redundancy: Studies with gene-edited cells and knockout mice show that blockade or loss of individual receptors does not completely inhibit alphavirus infection, suggesting functional redundancy among multiple entry factors

This functional diversity among LDLR family members highlights the complex interplay between viral entry mechanisms and host receptor utilization, providing multiple potential targets for therapeutic intervention .

What experimental approaches can be used to evaluate binding affinity between recombinant LDLRAD3 and viral particles?

Several sophisticated experimental approaches can be employed to evaluate binding affinity between recombinant LDLRAD3 and viral particles:

  • Bio-Layer Interferometry (BLI): This technique can detect binding in different orientations (receptor in solid phase or in solution). Research has shown that low-affinity interactions may only be detected when the receptor is in the solid phase .

  • Surface Plasmon Resonance (SPR): Provides real-time binding kinetics and affinity measurements.

  • Virus-Like Particle (VLP) Binding Assays: VLPs expressing viral envelope proteins can be used to assess binding to recombinant LDLRAD3 without requiring work with infectious virus .

  • Flow Cytometry-Based Binding Assays: Useful for quantifying binding of fluorescently labeled viral particles to cell surface-expressed LDLRAD3.

  • Competitive Inhibition Assays: Can determine if soluble LDLRAD3 constructs inhibit virus binding to cellular receptors .

Researchers have found that domain mapping combined with these binding studies can reveal critical interaction sites. For example, studies with LDLR identified LA3 as the key domain for EEEV binding, which informed the design of soluble decoy proteins with multiple LA3 repeats that effectively inhibited viral infection .

How can recombinant LDLRAD3 be utilized in the development of antiviral strategies against alphaviruses?

Recombinant LDLRAD3 can be leveraged for antiviral strategy development through several approaches:

  • Decoy Receptor Design: The creation of soluble receptor decoys that mimic LDLRAD3 binding domains can competitively inhibit virus attachment to cellular receptors. Similar approaches with LDLR have shown that soluble decoy proteins with multiple LA3 repeats effectively inhibit EEEV infection both in cell culture and in mice .

  • Structure-Based Drug Design: Detailed structural analysis of the LDLRAD3-virus interaction interface can inform the design of small molecule inhibitors that disrupt binding.

  • Antibody Development: Recombinant LDLRAD3 can be used as an immunogen to develop antibodies that block the virus-receptor interaction. These antibodies could have therapeutic potential.

  • Screening Platforms: High-throughput screening assays utilizing recombinant LDLRAD3 can identify compounds that disrupt virus-receptor interactions.

  • Combination Therapy Approaches: Since multiple LDLR family members can serve as alphavirus receptors, combining inhibitors targeting different receptors (LDLRAD3, LDLR, VLDLR) may enhance antiviral efficacy .

The development of LA3-based LDLR decoy proteins that demonstrated efficacy in mouse models provides a proof-of-concept for receptor-based therapeutic approaches that could be applied using LDLRAD3 .

What are the optimal conditions for expressing and purifying recombinant Xenopus tropicalis LDLRAD3 protein?

The optimal conditions for expressing and purifying recombinant Xenopus tropicalis LDLRAD3 protein depend on the expression system chosen:

For Yeast Expression System (Recommended):

  • Culture Conditions: Optimized medium composition with appropriate carbon source and induction parameters

  • Expression Temperature: Typically 28-30°C, lower than E. coli systems

  • Purification Strategy: Immobilized metal affinity chromatography (IMAC) for His-tagged protein

  • Buffer Composition: Tris-based buffer with 50% glycerol for stability

  • Yield: 0.2-2 mg/mL after concentration

  • Quality Control: SDS-PAGE and Western blot to confirm >90% purity

The yeast expression system is particularly valuable for LDLRAD3 because it allows for post-translational modifications that maintain the protein's native conformation, which is crucial for functional studies of receptor-ligand interactions .

Alternative expression systems should be considered based on specific research requirements:

  • E. coli: Higher yield but lacks post-translational modifications

  • Mammalian cells: Most native-like modifications but higher cost and lower yield

  • Baculovirus: Balance between yield and post-translational modifications

The choice between these systems should be guided by the intended application of the recombinant protein, with structural studies potentially requiring mammalian expression while high-throughput binding assays might utilize the more economical yeast system.

How can CRISPR/Cas9 be employed to study LDLRAD3 function in Xenopus tropicalis?

CRISPR/Cas9 genome editing offers powerful approaches to study LDLRAD3 function in Xenopus tropicalis:

Experimental Pipeline:

  • Target Selection and gRNA Design:

    • Identify conserved functional domains within LDLRAD3

    • Design guide RNAs targeting exonic regions to create frameshift mutations

    • Utilize Xenopus tropicalis genome databases to ensure specificity

  • Delivery Methods:

    • Microinjection of Cas9 protein/mRNA with gRNAs into fertilized eggs

    • Timing: Injection at one-cell stage for full organism knockout

    • Dosage: Optimize Cas9:gRNA ratios to maximize editing efficiency while minimizing toxicity

  • Mosaic Analysis Approach:

    • For studying receptor function in specific tissues, implement mosaic disruption strategies

    • This approach is particularly valuable for studying proteins where complete knockout may be lethal

  • Validation Methods:

    • T7 endonuclease assay or targeted sequencing to confirm editing

    • Western blotting to verify protein reduction/elimination

    • Functional assays to assess impact on alphavirus binding/entry

  • Phenotypic Analysis:

    • Evaluate developmental phenotypes

    • Assess susceptibility to alphavirus infection

    • Perform comparative viral entry assays between wild-type and edited animals

The efficiency of CRISPR/Cas9 in Xenopus tropicalis makes it particularly valuable for generating models that can then be used for in vivo studies of virus-host interactions, potentially revealing tissue-specific functions of LDLRAD3 .

What assays can be used to evaluate the functional activity of recombinant Xenopus tropicalis LDLRAD3 in virus binding studies?

Several specialized assays can be employed to evaluate the functional activity of recombinant Xenopus tropicalis LDLRAD3 in virus binding studies:

  • Virus Infection Inhibition Assay:

    • Pre-incubate viruses with soluble recombinant LDLRAD3

    • Measure reduction in infection rates in susceptible cell lines

    • Quantify via plaque reduction, immunofluorescence, or reporter gene expression

    • Controls should include irrelevant proteins of similar size and tag configuration

  • Pull-down Binding Assays:

    • Immobilize His-tagged LDLRAD3 on nickel resin

    • Incubate with purified virus or viral envelope proteins

    • Wash and elute bound components

    • Analyze by Western blot or mass spectrometry

  • Domain Mapping Experiments:

    • Generate LDLRAD3 constructs with specific domain deletions or mutations

    • Compare binding affinities to identify critical interaction regions

    • Example approach: Similar to studies with LDLR that identified LA3 domain as critical for EEEV binding

  • Competitive Binding Studies:

    • Test whether LDLRAD3 competes with other LDLR family members (LDLR, VLDLR, ApoER2)

    • Determine if combination of multiple receptor blockade enhances inhibition

    • This approach can reveal redundancy in receptor usage by alphaviruses

  • Cell Surface Expression and Virus Attachment:

    • Express LDLRAD3 in normally non-permissive cells

    • Measure gained ability to bind alphavirus particles

    • Quantify by flow cytometry or confocal microscopy

These functional assays provide complementary approaches to characterize the virus-receptor interaction and evaluate the potential of recombinant LDLRAD3 as an inhibitor of viral entry.

How should researchers interpret conflicting data between different LDLR family members in alphavirus entry studies?

When interpreting conflicting data regarding LDLR family members in alphavirus entry studies, researchers should consider several key factors:

Methodological Considerations:

  • Expression Level Differences: Varying expression levels of receptors across cell types and experimental systems can lead to apparently contradictory results .

  • Receptor Redundancy Analysis: Complete blockade of virus entry often requires inhibition of multiple receptors simultaneously, as demonstrated in studies where gene editing of individual receptors did not fully inhibit infection .

  • Binding Affinity Variations: Consider that low-affinity interactions (as seen with LDLR) may only be detectable in certain experimental setups, such as when the receptor is in solid phase but not in solution .

Data Integration Framework:

ConsiderationAnalytical ApproachExample
Cell Type SpecificityCompare results across multiple cell linesLDLR enhancement of EEEV infection varies between neuronal and non-neuronal cells
Virus Strain DifferencesTest multiple virus isolates/strainsDifferent alphaviruses show varying dependency on individual LDLR family members
Receptor CooperationCombinatorial knockout/inhibition studiesBlockade of multiple receptors may show synergistic inhibition effects
Binding Domain SpecificityDomain mapping and mutagenesisLA3 domain of LDLR is critical for EEEV binding but not equally important for all alphaviruses

By systematically evaluating these factors and using complementary experimental approaches, researchers can develop a more nuanced understanding of how different LDLR family members, including LDLRAD3, contribute to alphavirus entry in specific contexts.

What statistical approaches are most appropriate for analyzing LDLRAD3 binding and inhibition data?

When analyzing LDLRAD3 binding and inhibition data, researchers should employ robust statistical approaches tailored to the experimental design:

For Binding Affinity Studies:

  • Nonlinear Regression Analysis:

    • Fit binding data to appropriate models (e.g., one-site binding, two-site binding)

    • Calculate KD values and confidence intervals

    • Compare binding parameters across different conditions using extra sum-of-squares F test

  • Scatchard Plot Analysis:

    • Transform binding data to determine if multiple binding sites exist

    • Identify cooperative binding effects that may be relevant for multimeric viral proteins

For Inhibition Studies:

  • IC50 Determination:

    • Calculate half-maximal inhibitory concentration using dose-response curves

    • Apply four-parameter logistic regression for curve fitting

    • Report 95% confidence intervals for robust comparison between conditions

  • Combination Index Analysis:

    • When testing LDLRAD3 inhibitors in combination with other receptor antagonists

    • Determine synergistic, additive, or antagonistic effects

    • Use Chou-Talalay method for quantitative determination of combination effects

For Cell-Based Assays:

  • Appropriate Controls and Normalization:

    • Include both positive controls (known inhibitors) and negative controls

    • Normalize data to account for inter-assay variability

    • Consider using Z-factor analysis to assess assay quality

  • Multiple Comparison Corrections:

    • When comparing multiple conditions, apply Bonferroni or false discovery rate corrections

    • Use ANOVA with post-hoc tests for comparing multiple groups

What are the prospects for developing pan-alphavirus inhibitors based on recombinant LDLRAD3?

The development of pan-alphavirus inhibitors based on recombinant LDLRAD3 represents a promising but complex research direction:

Current Evidence Supporting Feasibility:

  • LDLRAD3 has been identified as a receptor for Venezuelan equine encephalitis virus

  • Other LDLR family members (LDLR, VLDLR, ApoER2) serve as receptors for multiple alphaviruses

  • Decoy receptor approaches using LA3 domain repeats from LDLR have shown efficacy against specific alphaviruses in vitro and in vivo

Key Research Priorities:

  • Cross-Alphavirus Binding Analysis:

    • Systematic evaluation of LDLRAD3 binding to diverse alphavirus strains

    • Identification of conserved binding epitopes across multiple alphaviruses

    • Determination if binding domains differ between encephalitic and arthritogenic alphaviruses

  • Optimized Decoy Design Strategies:

    • Development of chimeric constructs combining critical binding domains from multiple LDLR family members

    • Tandem repeat approaches similar to the LA3(5)-COMP design that showed efficacy for LDLR

    • Engineering modifications to enhance stability and half-life

  • Combination Approaches:

    • Evaluation of multi-receptor targeting strategies

    • Testing synergy between LDLRAD3-based inhibitors and those targeting other entry factors (MXRA8, NRAMP2)

  • Delivery System Development:

    • Nanoparticle formulations to improve bioavailability

    • Blood-brain barrier penetration strategies for encephalitic alphaviruses

    • Targeted delivery to tissues most affected by specific alphavirus infections

The success of LA3-based LDLR decoy proteins in inhibiting EEEV infection provides proof-of-concept that similar approaches using LDLRAD3 domains could potentially yield broad-spectrum alphavirus inhibitors .

How might comparative studies between mammalian and Xenopus tropicalis LDLRAD3 inform therapeutic development?

Comparative studies between mammalian and Xenopus tropicalis LDLRAD3 can provide valuable insights for therapeutic development:

Evolutionary Conservation Analysis:

  • Identifying highly conserved domains across species that maintain virus binding function

  • Determining if species-specific variations correlate with differential virus susceptibility

  • Mapping conserved post-translational modification sites that may influence receptor function

Structural-Functional Relationships:

  • Comparative structural biology approaches to determine if binding interfaces are preserved

  • Evaluation of whether Xenopus tropicalis LDLRAD3 shows differential binding affinity to alphaviruses compared to mammalian orthologs

  • Identification of domains that could be exploited for species-specific targeting of therapeutic interventions

Therapeutic Translation Implications:

  • Development of minimally immunogenic therapeutic proteins by focusing on highly conserved domains

  • Utilization of unique Xenopus tropicalis LDLRAD3 features that may confer advantageous binding or stability properties

  • Evaluation of whether recombinant Xenopus tropicalis LDLRAD3 could serve as an alternative therapeutic agent with potentially different immunogenicity profiles than human proteins

Experimental Model Advantages:

  • Xenopus tropicalis as a diploid organism with high genome synteny to humans provides translational relevance

  • The efficiency of CRISPR/Cas9 editing in Xenopus allows rapid testing of hypotheses about structure-function relationships

  • Xenopus models can bridge the gap between in vitro studies and mammalian models, potentially accelerating therapeutic development

By systematically comparing these orthologs, researchers can gain insights into both fundamental receptor biology and practical considerations for developing LDLRAD3-based therapeutics with optimal efficacy and safety profiles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.