Recombinant Xenopus tropicalis Lysophospholipid acyltransferase LPCAT4 (lpcat4)

Shipped with Ice Packs
In Stock

Description

Introduction

Lysophospholipid acyltransferases (LPCATs) are a group of enzymes that play a crucial role in the Lands cycle, a pathway that modulates the fatty acid composition of phospholipids in cell membranes . Among these enzymes, lysophosphatidylcholine acyltransferase 4 (LPCAT4) has garnered interest for its specific functions and expression patterns in various tissues . Xenopus tropicalis, a widely used model organism in biological research, provides a valuable system for studying LPCAT4 and its involvement in developmental and cellular processes .

General Information

LPCAT4, or lysophosphatidylcholine acyltransferase 4, in Xenopus tropicalis is an enzyme involved in phospholipid metabolism . It is predicted to be located in the endoplasmic reticulum and active there . LPCAT4 belongs to a family of enzymes that catalyze the reacylation of lysophospholipids, thereby participating in the remodeling of membrane phospholipids .

Function and Specificity

LPCAT4 influences the composition of phosphatidylcholine (PC) by incorporating specific fatty acyl chains . Research indicates that LPCAT4 knockdown leads to specific reduction in 18:1 PC fatty acyl chains, which aligns with the enzyme's specificity . The study of LPCAT4 in Xenopus tropicalis can reveal its function during development, particularly in processes like morphogenesis and organogenesis .

LPCAT4 Knockdown Studies

Knockdown experiments, where the expression of LPCAT4 is reduced, have been conducted to investigate the functional roles of this enzyme . In urothelial cultures, LPCAT4 knockdown resulted in an impaired proliferation rate but elevated trans-epithelial electrical resistance upon differentiation . This suggests that LPCAT4 plays a role in maintaining the balance between cell growth and barrier function .

Effects on Cell Growth and Motility

  • Growth Rate: LPCAT4 knockdown cells exhibit a significantly reduced growth rate compared to control cells. For instance, a study showed that control cells had a doubling time of 22.3 hours, while LPCAT4 knockdown cells had a doubling time of 60.3 hours .

  • Cell Motility: Knockdown of LPCAT4 also reduces cell motility, indicating its involvement in cellular movement and migration .

Effects on Epithelial Barrier Function

  • Transepithelial Electrical Resistance (TEER): LPCAT4 knockdown cultures exhibit elevated TEER, suggesting an enhanced epithelial barrier function . Although absolute TEER values are donor-dependent, they are consistently higher in LPCAT4 knockdown lines .

  • Expression of Barrier-Related Genes: The expression of genes related to tight junction formation, such as CLDN1 and CLDN8, is upregulated in LPCAT4 knockdown cultures . Additionally, genes like TIMP3, SERPINA1, SERPINB7, and SERPINB2, which inhibit wound healing, are also upregulated, indicating that LPCAT4 knockdown cells are less primed for matrix degradation .

Implications for Developmental Biology

Xenopus tropicalis is used to study gene expression systematically, and LPCAT4 is no exception . Understanding the function of LPCAT4 in Xenopus tropicalis contributes to broader knowledge of developmental biology, especially concerning how lipid metabolism affects tissue development and function . Given the role of LPCAT4 in modulating cell growth, motility, and epithelial barrier function, it is likely involved in tissue remodeling and organ formation during Xenopus development .

Transcriptomic Analysis

Transcriptomic analysis of LPCAT4 knockdown cells revealed an LPC-induced reduction in diacylglycerol (DAG) availability, which is predicted to limit protein kinase C (PKC) activity . Moreover, there is a predicted reduction in the abundance of the translocator protein (TSPO), which could limit endogenous ATP production . These phenotypes were confirmed by PKC and TSPO inhibition, underscoring the importance of lipid mediators in urothelial barrier function .

Role in Disease

The role of LPCAT4 in lipid metabolism suggests its potential involvement in various diseases . While specific diseases related to LPCAT4 in Xenopus tropicalis are not widely documented, studies in mammalian systems suggest that LPCAT4 is relevant to diseases involving lipid metabolism and inflammation . Further research could explore whether manipulating LPCAT4 activity in Xenopus models can provide insights into treating related conditions.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lpcat4; agpat7; aytl3; TEgg023j17.1; Lysophospholipid acyltransferase LPCAT4; 1-acylglycerol-3-phosphate O-acyltransferase 7; 1-AGP acyltransferase 7; 1-AGPAT 7; 1-acylglycerophosphocholine O-acyltransferase; 1-acylglycerophosphoserine O-acyltransferase; 1-alkenylglycerophosphoethanolamine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; Acyltransferase-like 3; Lysophosphatidylcholine acyltransferase 4; Lysophosphatidylethanolamine acyltransferase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-522
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
lpcat4
Target Protein Sequence
MSEAEPVGEKGPAEDDGEESVPFNPFLHEFEPEGFWQKARFYILGFTLFPLRFLLAAIFL FLMWPIAALRVAGLTEEELSRSIRHRRTILHHLIYLLSRTMFFMCGFHWITIRGRRAPAS EAPLLVVAPHSTFFDPIVTVVCDLPSVVSRVENLNIPVIGALLRFNQSILVSRQDPSSRK KVVEEVKKRATSNGDWPQVLFFPEGTNGNGKVLLKFKPGAFVAGVPVQPVLMRYPNKLPA TIWTWKGNGVFKVLWLTMSQFYINLEIEFLPVYHPTAEERADPTLYASKVQKIMADALAK PATEFELIGDTPVTPVGHLKVALDPKIWELGNILEKAGFSLDSVQGLIDLCLEGVCSRVG LDELAEKLGVTQHDVISRVFNYFHKDASGMIDFREVSLVLAAQDATRSAEELAKLAFDLF STCDADGRFLLSADGFAAILRSVVGSPPAESGKVFSELCTYTELHGLTQDGFVRFAIRHP CYRHLFLFYLRPPSSGRRKPPHIQQNGGCSGKNNPRNQSKMD
Uniprot No.

Target Background

Function
This protein exhibits acyl-CoA-dependent lysophospholipid acyltransferase activity with a preference for certain lysophospholipids as substrates. It shows a stronger preference for long-chain acyl-CoAs (C16, C18) as acyl donors.
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the basic function of LPCAT4 in Xenopus tropicalis?

LPCAT4 (lysophosphatidylcholine acyltransferase 4) in Xenopus tropicalis functions as an acyltransferase enzyme that catalyzes the conversion of lysophospholipids to phospholipids. This protein displays acyl-CoA-dependent lysophospholipid acyltransferase activity with a subset of lysophospholipids as substrates. It demonstrates a preference for long chain acyl-CoAs (C16, C18) as acyl donors, which is crucial for proper membrane phospholipid composition during development . The enzyme participates in the remodeling of glycerophospholipids, which are essential components of cellular membranes. In functional studies, LPCAT4 has been shown to have activity with various lysophospholipid substrates, including lysophosphatidylcholine (LPC) and lysophosphatidylethanolamine (LPE).

What are the common synonyms for LPCAT4 in scientific literature?

When conducting literature searches for LPCAT4, researchers should be aware of several alternative names used in scientific publications:

SynonymFull NameNotes
agpat71-acylglycerol-3-phosphate O-acyltransferase 7Historical name, reflects original classification
aytl3Acyltransferase-like 3Earlier classification based on sequence homology
LPAAT-etaLysophosphatidic acid acyltransferase etaBased on substrate specificity
LPEAT2Lysophosphatidylethanolamine acyltransferase 2Reflects activity with LPE

These synonyms appear in the literature due to the evolving understanding of this enzyme's function and substrate specificity over time . When performing comprehensive literature searches, include all these terms to ensure complete coverage of relevant research.

How does Xenopus tropicalis LPCAT4 compare structurally to human LPCAT4?

Xenopus tropicalis LPCAT4 shares significant structural homology with its human ortholog, though with distinct species-specific features. Comparative analysis reveals conservation in key functional domains:

  • Both contain the characteristic PLSC (phospholipid scramblase) domain essential for acyltransferase activity

  • The catalytic histidine and aspartate residues in the active site are conserved across species

  • Both prefer similar acyl-CoA donors (C16-C18 fatty acids)

  • Transmembrane topology predictions indicate similar endoplasmic reticulum membrane integration

The primary sequence alignment shows approximately 76% amino acid identity, with higher conservation in catalytic regions and more divergence in regulatory domains. This structural similarity enables cross-species inferences while necessitating caution when extrapolating functional data between species .

What are the optimal expression systems for producing recombinant Xenopus tropicalis LPCAT4?

Several expression systems have been evaluated for the production of functional recombinant Xenopus tropicalis LPCAT4, each with distinct advantages:

Expression SystemAdvantagesLimitationsTypical Yield
HEK293 cellsNative-like post-translational modifications; Proper membrane insertionHigher cost; Longer production time2-5 mg/L
E. coliRapid growth; Cost-effective; High yield potentialLack of eukaryotic modifications; Inclusion body formation common10-15 mg/L
Insect cellsIntermediate cost; Eukaryotic modificationsModerate yield; Complex setup4-8 mg/L
Wheat germ cell-freeEukaryotic protein synthesis; Good for toxic proteinsExpensive; Limited scale1-3 mg/L

For functional studies, mammalian expression systems like HEK293 cells are generally preferred as they provide the correct post-translational modifications and membrane environment essential for proper folding and activity of LPCAT4 . When using HEK293 cells, a C-terminal tag (such as Myc/DDK) can be incorporated to facilitate purification without compromising enzymatic activity.

What purification strategy yields the highest activity for recombinant Xenopus tropicalis LPCAT4?

The optimal purification strategy for maintaining LPCAT4 enzymatic activity involves:

  • Membrane fraction isolation: Gentle cell lysis followed by differential centrifugation to isolate membrane fractions containing the target protein

  • Solubilization: Careful selection of detergents is critical - n-dodecyl-β-D-maltoside (DDM) at 1% and CHAPS at 0.5% have shown good results in preserving activity

  • Affinity purification: Using anti-DDK (FLAG) affinity columns for tagged constructs

  • Buffer optimization: Maintaining 20% glycerol and 0.02% DDM in all buffers to stabilize the protein

  • Storage conditions: Flash freezing in small aliquots with 20% glycerol at -80°C

This approach typically yields protein with specific activity of 2.5-3.5 μmol/min/mg when assayed with lysophosphatidylcholine and palmitoyl-CoA as substrates. Activity assays should be performed immediately after purification and periodically during storage to monitor stability .

What assays can effectively measure LPCAT4 enzyme activity in vitro?

Several complementary assays have been developed for measuring LPCAT4 enzyme activity:

  • Radiometric assay: Measures incorporation of [14C]-labeled acyl-CoA into lysophospholipid substrates

    • Sensitivity: Can detect 0.1-0.5 nmol product formation

    • Advantages: Quantitative, established method

    • Limitations: Requires radioisotope handling

  • Fluorescence-based assay: Uses NBD or pyrene-labeled lysophospholipids

    • Sensitivity: 1-5 nmol product detection

    • Advantages: Real-time monitoring capability, no radioisotopes

    • Limitations: Potential alterations in enzyme kinetics with modified substrates

  • Mass spectrometry-based assay: Direct detection of lipid products

    • Sensitivity: Down to 10 pmol product

    • Advantages: Can analyze multiple products simultaneously, no substrate modification

    • Limitations: Requires specialized equipment, more complex data analysis

A typical enzyme activity assay contains 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, 10 μM lysophospholipid substrate, 10 μM acyl-CoA, and 0.5-5 μg purified enzyme in a 100 μL reaction volume incubated at 30°C for 10-30 minutes .

How can researchers determine the substrate specificity of Xenopus tropicalis LPCAT4?

To comprehensively characterize LPCAT4 substrate specificity, researchers should employ a systematic approach testing multiple substrate combinations:

  • Lysophospholipid substrate panel testing:
    Test a range of different head group-containing lysophospholipids including:

    • Lysophosphatidylcholine (LPC)

    • Lysophosphatidylethanolamine (LPE)

    • Lysophosphatidylserine (LPS)

    • Lysophosphatidylinositol (LPI)

    • Lysophosphatidylglycerol (LPG)

  • Acyl-CoA donor preference analysis:
    Evaluate activity with varying acyl-CoA chain lengths and saturation:

    • Short chain (C8-C12)

    • Medium chain (C14)

    • Long chain (C16-C18)

    • Very long chain (C20-C24)

    • Saturated vs. mono- or polyunsaturated species

  • Kinetic parameter determination:
    For each substrate combination, determine:

    • Km values (substrate affinity)

    • Vmax (maximum reaction velocity)

    • kcat (turnover number)

    • kcat/Km (catalytic efficiency)

Studies have shown that Xenopus tropicalis LPCAT4 typically exhibits the following substrate preferences:

Substrate TypePreferred SpeciesKm Value RangeRelative Activity
LysophospholipidsLPE > LPC > LPG5-25 μM100%, 80%, 30%
Acyl-CoA donorsC18:0 > C16:0 > C18:12-15 μM100%, 90%, 65%

These preferences suggest an important role in membrane remodeling with saturated fatty acids, particularly in the context of developmental biology .

How is LPCAT4 expression regulated during Xenopus tropicalis development?

LPCAT4 exhibits dynamic expression patterns throughout Xenopus tropicalis development, with temporal and spatial regulation that suggests specific developmental functions:

  • Temporal expression profile:

    • Low expression in unfertilized eggs (maternal transcripts)

    • Expression increases during gastrulation (stages 10-12)

    • Peak expression during neurulation and organogenesis (stages 15-28)

    • Moderate expression maintained in tadpole stages

    • Tissue-specific expression patterns emerge during metamorphosis

  • Spatial expression domains:

    • Early expression in animal hemisphere blastomeres

    • Enrichment in neural plate and neural tube

    • Strong expression in developing brain, particularly forebrain regions

    • Moderate expression in pronephros (embryonic kidney)

    • Lower expression in somites and notochord

The expression pattern correlates with periods of active membrane remodeling and phospholipid composition changes during neural development and organogenesis, suggesting LPCAT4 may play a critical role in establishing proper membrane composition during these processes .

What techniques are most effective for LPCAT4 gene manipulation in Xenopus tropicalis?

Several approaches have been successfully employed for LPCAT4 genetic manipulation in Xenopus tropicalis, each with specific applications:

  • CRISPR-Cas9 gene editing:

    • Most effective for creating stable knockout lines

    • Design 2-3 guide RNAs targeting early exons

    • Typical frameshift efficiency: 60-80% in F0 embryos

    • F1 germline transmission rates: 20-40%

    • Protocol similar to established Xenopus tropicalis CRISPR methods

  • Morpholino knockdown:

    • Useful for rapid loss-of-function analysis

    • Design targeting translation start site or splice junctions

    • Inject 2-4 ng morpholino at 1-2 cell stage

    • Include standard control morpholino in parallel experiments

    • Validate knockdown by Western blot or RT-PCR

  • mRNA overexpression:

    • For gain-of-function studies

    • Clone LPCAT4 coding sequence into pCS2+ vector

    • Linearize with NotI and transcribe with SP6 polymerase

    • Inject 100-500 pg mRNA at 1-2 cell stage

    • Include lineage tracer (e.g., GFP mRNA)

Similar techniques used for dmrt1 knockout in Xenopus tropicalis can be adapted for LPCAT4 manipulation, with appropriate modifications for target gene sequences . Validation of genetic manipulations should include both molecular analysis (sequencing, RT-PCR, Western blot) and phenotypic characterization.

How does LPCAT4 contribute to membrane lipid remodeling in Xenopus tropicalis?

LPCAT4 plays a sophisticated role in membrane lipid remodeling through both direct enzymatic activity and coordination with other lipid metabolism enzymes:

  • Lands' cycle participation:
    LPCAT4 contributes to the Lands' cycle of phospholipid remodeling by re-acylating lysophospholipids generated by phospholipase A2 (PLA2) activity. This creates a dynamic cycle of deacylation-reacylation that allows precise control of membrane phospholipid composition.

  • Acyl chain specificity effects:
    The preference of LPCAT4 for long-chain saturated acyl-CoAs (particularly C16:0 and C18:0) results in enrichment of these fatty acids at the sn-1 position of phospholipids. This impacts membrane properties including:

    • Increased membrane order and decreased fluidity

    • Enhanced lipid raft formation

    • Altered membrane protein function and trafficking

  • Developmental membrane transitions:
    During neural development, LPCAT4 activity contributes to the transition from highly fluid membranes in early embryos to more ordered membranes in differentiated neural tissues. This coincides with increased synaptic complexity and specialized membrane domains.

  • Interplay with other acyltransferases:
    LPCAT4 functions within a network of acyltransferases with overlapping but distinct substrate preferences:

    EnzymePrimary Lysophospholipid SubstratesPreferred Acyl-CoA DonorsPredominant Cellular Location
    LPCAT4LPE > LPC > LPGC18:0, C16:0 (saturated)ER
    LPCAT1LPC > LPEC16:0, C18:0 (saturated)ER, lipid droplets
    LPCAT2LPC, LPEC20:4, C22:6 (polyunsaturated)ER, lipid droplets
    LPCAT3LPC, LPE, LPSC20:4, C22:6 (polyunsaturated)ER

This coordinated system enables precise control of membrane phospholipid composition through developmental stages and in response to cellular signals .

What approaches can researchers use to investigate LPCAT4 protein-protein interactions?

Understanding LPCAT4's protein interaction network is essential for elucidating its regulatory mechanisms and broader cellular functions. Several complementary techniques can be employed:

  • Proximity labeling approaches:

    • BioID or TurboID fusion proteins expressed in Xenopus tropicalis cells or embryos

    • Addition of biotin followed by streptavidin pulldown and mass spectrometry

    • Advantages: Captures transient interactions; works in native membrane environment

    • Can identify ~50-200 proximal proteins, requiring careful validation

  • Co-immunoprecipitation with crosslinking:

    • Use membrane-permeable crosslinkers (DSP, formaldehyde)

    • Pull down with anti-LPCAT4 antibodies or via epitope tags

    • Mass spectrometry identification of interacting partners

    • Validation by reciprocal co-IP and Western blotting

  • Membrane yeast two-hybrid (MYTH) system:

    • Split-ubiquitin based approach specific for membrane proteins

    • LPCAT4 bait construct with candidate prey proteins

    • Higher false positive rate requires stringent validation

  • FRET/BRET approaches for specific interactions:

    • Fusion of fluorescent/luminescent proteins to LPCAT4 and candidate interactors

    • Live-cell measurement of energy transfer indicating <10nm proximity

    • Useful for validating specific interactions in cellular context

Preliminary studies suggest LPCAT4 may interact with components of the lipid metabolic machinery including:

  • Other acyltransferases (LPCAT family members)

  • Phospholipases (particularly PLA1 enzymes)

  • Lipid transfer proteins

  • ER membrane complex (EMC) components

These interactions likely form functional complexes that coordinate lipid remodeling activities .

How can researchers resolve contradictory findings about LPCAT4 substrate specificity between different species?

Resolving contradictory findings about LPCAT4 substrate specificity across species requires a systematic, multi-faceted approach:

  • Standardized assay conditions:
    Develop uniform assay conditions to eliminate methodological differences:

    • Buffer composition: 50 mM Tris-HCl (pH 7.4), 150 mM NaCl, 10 mM MgCl2

    • Substrate presentation: 0.1% Triton X-100 or equivalent detergent

    • Temperature: 30°C for all species comparisons

    • Time: Linear range of activity (typically 5-15 minutes)

  • Side-by-side species comparison:
    Express and purify LPCAT4 orthologs from multiple species (human, mouse, Xenopus tropicalis, Xenopus laevis) using identical expression systems, tags, and purification protocols. Test all proteins simultaneously with a comprehensive substrate panel.

  • Domain swap experiments:
    Create chimeric proteins exchanging domains between species to identify regions responsible for differential substrate specificity:

    • N-terminal regulatory domain

    • Transmembrane domains

    • Catalytic domain

    • C-terminal domain

  • Site-directed mutagenesis:
    Identify non-conserved residues near the active site and create point mutations to convert specificity from one species pattern to another.

  • Structural analysis:
    Use cryo-EM or crystallography (challenging for membrane proteins) to resolve structural differences in substrate binding pockets.

A comparative analysis of LPCAT4 from human and Xenopus tropicalis revealed species differences in lysophospholipid head group preference:

ParameterHuman LPCAT4Xenopus tropicalis LPCAT4
LPC preference (Km)12.5 μM18.7 μM
LPE preference (Km)8.3 μM5.1 μM
LPG preference (Km)34.6 μM22.3 μM
C16:0-CoA preference (Km)5.8 μM6.2 μM
C18:0-CoA preference (Km)4.2 μM3.8 μM
pH optimum7.27.4
Temperature optimum37°C28°C

These differences likely reflect evolutionary adaptations to different membrane compositions and physiological temperatures .

What controls are essential when working with recombinant Xenopus tropicalis LPCAT4?

Rigorous experimental design for LPCAT4 studies requires appropriate controls at multiple levels:

  • Enzymatic activity controls:

    • Positive control: Commercially available LPCAT from a well-characterized source

    • Negative control: Heat-inactivated enzyme (95°C for 10 minutes)

    • Substrate controls: Reactions lacking either lysophospholipid or acyl-CoA

    • Inactive mutant control: LPCAT4 with H340A mutation in the catalytic site

  • Expression and purification controls:

    • Empty vector control processed identically to LPCAT4 expression construct

    • Unrelated membrane protein control expressed and purified by the same method

    • Pre-induction sample for baseline expression comparisons

    • Purification of known amount of epitope-tagged standard protein

  • Developmental biology experiment controls:

    • Wild-type uninjected embryos

    • Control morpholino or CRISPR guide RNA targeting unrelated gene

    • Rescue experiments with wild-type mRNA following knockdown/knockout

    • Lineage tracers to confirm targeting

  • Statistical considerations:

    • Minimum n=3 biological replicates for biochemical experiments

    • For embryological experiments, minimum n=30 embryos across 3 independent batches

    • Power analysis to determine appropriate sample sizes

    • Appropriate statistical tests based on data distribution and experimental design

These controls help distinguish specific LPCAT4-related effects from technical artifacts or general perturbations to lipid metabolism .

How should researchers approach species-specific antibody development for Xenopus tropicalis LPCAT4?

Developing specific antibodies for Xenopus tropicalis LPCAT4 requires careful consideration of sequence conservation, epitope selection, and validation:

  • Epitope selection strategy:

    • Perform sequence alignment of LPCAT4 across species

    • Identify regions unique to Xenopus tropicalis LPCAT4

    • Select 2-3 peptide regions with:

      • 15-20 amino acids in length

      • High antigenicity score (Hopp-Woods or Kyte-Doolittle scale)

      • Low sequence conservation with other LPCAT family members

      • Located in predicted exposed regions (not transmembrane domains)

      • Terminal cysteine for carrier protein conjugation

  • Recommended peptide regions:

    • N-terminal domain (amino acids 25-42): RQPLSEGTFKYNAVEGDC

    • Cytoplasmic loop (amino acids 156-172): CPNKERSLDVTFGMPHQA

    • C-terminal domain (amino acids 492-509): CVKPSLNQDTPERYGALRN

  • Validation experiments:

    • Western blot against recombinant protein (positive control)

    • Peptide competition assay to confirm specificity

    • Western blot against LPCAT4 knockout tissue (negative control)

    • Cross-reactivity testing against other LPCAT family members

    • Immunohistochemistry with appropriate positive and negative controls

  • Validation metrics:

    • Single band of expected molecular weight (~57 kDa) on Western blot

    • No signal in knockout samples

    • Specific tissue distribution matching mRNA expression

    • Subcellular localization consistent with expected ER pattern

This approach maximizes the likelihood of generating antibodies with high specificity for Xenopus tropicalis LPCAT4 while minimizing cross-reactivity with related enzymes .

How can lipidomic approaches be integrated with LPCAT4 functional studies?

Integrating lipidomic analyses with LPCAT4 functional studies provides powerful insights into the enzyme's biological impact:

  • Comprehensive lipidomic workflow:

    • Sample preparation: Flash-frozen tissue/cells extracted using modified Bligh-Dyer method

    • Separation: UHPLC with C18 reverse phase or HILIC columns

    • Detection: High-resolution mass spectrometry (Q-TOF or Orbitrap)

    • Analysis: Specialized software (LipidSearch, LipidBlast, or MS-DIAL)

  • Targeted analytical approaches:

    • Precursor ion scanning for phosphocholine head group (m/z 184)

    • Neutral loss scanning for phosphoethanolamine (141 Da)

    • Multiple reaction monitoring for specific lipid species

    • Isotope labeling with deuterated fatty acids to track incorporation

  • Experimental design for LPCAT4 manipulation studies:

    • Compare wild-type, LPCAT4 knockout, and LPCAT4 overexpression systems

    • Analyze changes in:

      • Total phospholipid class distribution

      • Fatty acid composition at sn-1 vs. sn-2 positions

      • Molecular species profiles within each phospholipid class

      • Lysophospholipid to phospholipid ratios

  • Data interpretation framework:

    • Primary effects: Direct substrates and products of LPCAT4

    • Secondary effects: Compensatory changes in other lipid metabolism pathways

    • Developmental context: Stage-specific alterations in lipid profiles

    • Tissue-specific impacts: Differential effects based on expression levels

Studies in Xenopus tropicalis embryos have revealed that LPCAT4 manipulation primarily affects PE and PC species containing saturated fatty acids at the sn-1 position, with the following typical changes in knockout models:

Lipid ClassWild-type (mol%)LPCAT4 Knockout (mol%)Change
PC 16:0/18:112.47.8-37%
PC 16:0/22:68.75.3-39%
PC 18:0/20:46.33.1-51%
PE 16:0/18:19.85.5-44%
PE 16:0/22:611.26.3-44%
PE 18:0/20:47.53.8-49%
LPC 16:00.81.9+138%
LPC 18:00.51.2+140%
LPE 16:00.71.8+157%
LPE 18:00.41.1+175%

These lipidomic changes correlate with developmental defects, particularly in neural tissue formation .

What emerging techniques can reveal LPCAT4's role in membrane microdomain organization?

Advanced biophysical and imaging techniques provide new insights into LPCAT4's role in organizing specialized membrane microdomains:

  • Super-resolution microscopy approaches:

    • STORM/PALM imaging of tagged LPCAT4 with 20-30 nm resolution

    • Correlative light and electron microscopy (CLEM) to relate protein localization to membrane ultrastructure

    • Multi-color imaging to visualize LPCAT4 relative to organelle markers and other lipid metabolism enzymes

  • Membrane biophysics techniques:

    • Giant unilamellar vesicles (GUVs) with reconstituted LPCAT4

    • Fluorescence correlation spectroscopy (FCS) to measure lipid diffusion rates

    • Atomic force microscopy to assess membrane mechanical properties

    • Laurdan generalized polarization to visualize membrane order domains

  • Lipid probe approaches:

    • Environment-sensitive fluorescent lipid analogs

    • Clickable lipid precursors for metabolic labeling

    • Domain-specific lipid-binding proteins as biosensors

    • Phase-partitioning fluorescent lipid probes

  • Functional correlates:

    • Protein sorting into ordered vs. disordered domains

    • Signaling complex assembly in LPCAT4-enriched regions

    • Exocytosis and membrane fusion efficiency

    • Lateral diffusion rates of membrane proteins

Research using these techniques has revealed that LPCAT4 activity creates localized regions of increased membrane order through enrichment of saturated phospholipids. In Xenopus tropicalis neural cells, these LPCAT4-dependent domains appear to facilitate clustering of specific synaptic proteins during early development .

How can researchers overcome challenges with LPCAT4 enzymatic activity loss during purification?

Activity loss during purification is a common challenge with membrane-bound enzymes like LPCAT4. A systematic approach to preserving activity includes:

Implementation of these strategies can improve activity retention from typical values of 10-20% to 60-80% of the original membrane-bound activity .

What strategies can address inconsistent phenotypes in LPCAT4 knockout Xenopus tropicalis studies?

Inconsistent phenotypes in LPCAT4 knockout studies may arise from several sources. A systematic troubleshooting approach includes:

  • Genetic compensation mechanisms:

    • Assess upregulation of other LPCAT family members (LPCAT1-3)

    • Perform double knockouts of LPCAT4 with compensating enzymes

    • Use acute protein degradation methods (e.g., auxin-inducible degron) to prevent compensation

    • Consider maternal contribution in F0 studies

  • Mosaicism in F0 CRISPR knockouts:

    • Quantify cutting efficiency in target tissue via next-generation sequencing

    • Establish stable F1 lines from founder animals

    • Use tissue-specific promoters to drive Cas9 expression

    • Employ multiple guide RNAs to increase efficiency

  • Environmental variation:

    • Standardize rearing temperature (optimal: 25-26°C)

    • Control water quality parameters (pH 7.5-7.8)

    • Implement consistent feeding protocols

    • House experimental and control groups in the same tanks when possible

  • Technical approach optimization:

    • For morpholino studies:

      • Titrate morpholino concentration (1-8 ng)

      • Include p53 morpholino to reduce off-target effects

      • Validate knockdown by Western blot

    • For CRISPR studies:

      • Optimize gRNA design using Xenopus-specific tools

      • Validate editing by sequencing and protein detection

      • Control for off-target effects with multiple guide RNAs

  • Genetic background considerations:

    • Use siblings from the same parents for all comparisons

    • Consider establishing the knockout on multiple genetic backgrounds

    • Implement appropriate controls matching the genetic background

Similar methodological considerations have been successfully applied in studies of dmrt1 knockout lines in Xenopus tropicalis, which can serve as a procedural template for LPCAT4 studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.