Recombinant Xenopus tropicalis MARVEL domain-containing protein 2 (marveld2)

Shipped with Ice Packs
In Stock

Description

Functional Role in Biological Systems

Marveld2 is integral to maintaining epithelial barrier integrity, particularly at tricellular junctions where three cells meet.

Tight Junction Assembly and Barrier Function

  • Primary Role: Stabilizes tricellular tight junctions in epithelial tissues (e.g., inner ear, gastrointestinal tract) .

  • Interactions: Binds to scaffolding proteins (TJP1, TJP2, TJP3) and transmembrane components (occludin, claudins) .

  • Defects: Mutations in MARVELD2 cause autosomal recessive nonsyndromic hearing loss (DFNB49) due to disrupted cochlear ion homeostasis .

Species-Specific Insights

In Xenopus tropicalis, marveld2 likely mirrors its mammalian counterparts in developmental and barrier-forming processes. Its study in this model organism aids in understanding epithelial morphogenesis and disease mechanisms .

Experimental Findings

StudyKey Observation
Hearing Loss ModelsMARVELD2 knockout in mice causes progressive deafness due to hair cell degeneration .
Splice MutationsTruncations in the occludin-ELL domain disrupt ZO-1 binding .
Tissue DistributionExpressed in epithelial barriers (e.g., inner ear, intestine) .

Comparative Analysis with Orthologs

SpeciesProteinKey Differences
Homo sapiensMARVELD2 (tricellulin)558 aa; C-terminal truncations cause DFNB49 .
Mus musculusMarveld2Homologous to human; used in knockout studies .
Xenopus tropicalismarveld2Full-length recombinant form available for functional studies .

Challenges and Future Directions

  • Purification: His-tagged proteins require optimized buffer conditions to maintain solubility.

  • Functional Studies: Limited data on Xenopus marveld2’s role in embryonic development.

  • Therapeutic Potential: Insights into tight junction dynamics may inform treatments for epithelial barrier disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
marveld2; mrvldc2; TGas093b21.1; MARVEL domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-568
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
marveld2
Target Protein Sequence
MSGGGSSSGPRSKDRNLNGRSAQYDEVPADPRHPETNLETLHDRDLALSADPLPPPPLPL HPPFGAEFYPSDSEEPVTTLELRPVRRFIPDSWKNIFKGKKENPWENPMTEINYTSGGVP CSPPRSPSLPASEPHGKNLAGDSKTVASSYRDPYGGSGGSYNSRREEEAMLPHDPYGSLG RQTQTVKTYSERVEEYNMRYAYMKSWAGLLRILCIVELLLGAAVFACVTAYIHKDNEWYN MFGYSQPYGYTASMQGGYYYSGPKTPFVLVVAGLAWIVTIILLVLGMSMYYRTILLDSTW WPLTEFGINISLFILYMAGAIVYVNDTNRGGLCYYQLFNTPVNASFCRVEGGQTAAIIFL FVSMLMYFISAMVSLKLWRHESARKRREFLGQEMNPNQISPPKVMREVALGNGHMIDVPD QQRDMRKVEMKPELLSGYIPAGHIPKPIVMPDYVAKYQAIKAEDERERYKAVFNDQFAEY KELHAEVQAVMKKFSELDAVMQKLPRNPENQHEYERIAKVLQEYQKKKNEPTFLEKKERC EYLKNKLSHIKQRIQEYDKVMDWNDGYN
Uniprot No.

Target Background

Function
Recombinant Xenopus tropicalis MARVEL domain-containing protein 2 (marveld2) may play a role in the formation of the epithelial barrier.
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.

Q&A

What is MARVEL domain-containing protein 2 (Marveld2) in Xenopus tropicalis?

Marveld2 is a protein found in Xenopus tropicalis (Western clawed frog) that belongs to the MARVEL (MAL and Related proteins for VEsicle trafficking and membrane Link) domain-containing family. It is a full-length protein consisting of 568 amino acids encoded by the marveld2 gene (UniProt ID: Q0IHQ3). The protein contains characteristic transmembrane regions that form part of the MARVEL domain structure . Xenopus tropicalis serves as an excellent model organism for studying marveld2 function due to its diploid genome that shows high synteny with the human genome, making it valuable for comparative studies of human disease states .

How can recombinant Xenopus tropicalis Marveld2 protein be expressed and purified?

Recombinant Xenopus tropicalis Marveld2 protein can be efficiently expressed and purified using the following methodological approach:

  • Expression system selection: E. coli serves as an effective heterologous expression system for producing recombinant Marveld2 .

  • Vector construction: The full-length coding sequence (1-568aa) should be cloned into an expression vector containing an N-terminal His-tag for purification purposes.

  • Expression conditions:

    • Transform the construct into an appropriate E. coli strain

    • Induce protein expression under optimized conditions (temperature, IPTG concentration, duration)

    • Harvest cells by centrifugation

  • Purification protocol:

    • Lyse cells using appropriate buffer systems

    • Perform affinity chromatography using Ni-NTA or similar matrix to capture His-tagged protein

    • Elute with imidazole gradient

    • Perform SDS-PAGE analysis to confirm purity (>90% purity can be achieved)

  • Post-purification processing:

    • Dialyze against appropriate buffer

    • Lyophilize to powder form for long-term storage

What are the optimal storage conditions for recombinant Xenopus tropicalis Marveld2?

For maximum stability and activity retention of recombinant Xenopus tropicalis Marveld2, the following storage protocols are recommended:

  • Short-term storage (up to one week):

    • Store working aliquots at 4°C

    • Avoid repeated freeze-thaw cycles which can cause protein degradation

  • Long-term storage:

    • Store lyophilized powder at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use

    • Reconstituted protein should be stored with glycerol

  • Reconstitution protocol:

    • Briefly centrifuge vial prior to opening

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add 5-50% glycerol (final concentration recommended: 50%)

    • Aliquot for long-term storage at -20°C/-80°C

  • Storage buffer composition:

    • Tris/PBS-based buffer

    • 6% Trehalose

    • pH 8.0

What experimental approaches can be used to study Marveld2 function in Xenopus tropicalis?

Several experimental approaches can be employed to elucidate Marveld2 function in Xenopus tropicalis:

  • Genome editing techniques:

    • CRISPR/Cas9 and TALEN systems are highly effective in Xenopus tropicalis for generating gene knockouts

    • These techniques allow for mosaic disruption of marveld2, enabling the generation of loss-of-function models

  • Expression analysis:

    • RT-PCR for temporal expression patterns

    • In situ hybridization for spatial expression patterns

    • Immunohistochemistry using specific antibodies against Marveld2

  • Functional assays:

    • Embryo microinjection of mRNA or morpholinos

    • Transgenic reporter approaches for promoter analysis

    • Co-immunoprecipitation for protein interaction studies

  • Phenotypic analysis:

    • Morphological examination of embryos and tadpoles

    • Histological assessment of affected tissues

    • Behavioral assays to assess functional deficits

These approaches take advantage of Xenopus tropicalis' external embryo development and transparent tadpoles, which facilitate experimental manipulation and post-analysis of animals .

How can Marveld2 mutations be effectively analyzed in Xenopus tropicalis?

Analysis of Marveld2 mutations in Xenopus tropicalis requires a comprehensive approach combining genetic, molecular, and phenotypic assessments:

  • Mutation generation:

    • CRISPR/Cas9 targeting specific sites in the marveld2 gene

    • Design sgRNAs targeting conserved domains or specific functional regions

  • Genotyping strategies:

    • DNA extraction from tadpole tail clips

    • PCR amplification of targeted regions

    • Sequencing analysis to confirm mutations

    • T7 endonuclease I assay or heteroduplex mobility assay for rapid screening

  • Molecular confirmation:

    • Design primers for targeted regions (e.g., forward primer: 5′-CACCTGATCTTCTTCCTC-3′, reverse primer: 5′-GGGAAATCAGCTTATCTTAT-3′ for amplifying mutation sites)

    • Sanger sequencing to verify specific mutations

    • RT-PCR to assess transcript levels and potential splicing effects

  • Bioinformatic analysis:

    • Use predictive tools (SIFT, PolyPhen, MutationTaster, FATHMM, CADD, Varsome) to assess potential impact of mutations

    • Compare with known human mutations in homologous regions

This systematic approach allows researchers to thoroughly characterize marveld2 mutations and their functional consequences in Xenopus tropicalis.

What role does Marveld2 play in developing Xenopus tropicalis tissues?

Marveld2 plays critical roles in developing Xenopus tropicalis tissues, particularly in epithelial barrier formation and sensory system development:

  • Epithelial barriers:

    • Contributes to tight junction formation in epithelial cells

    • Regulates paracellular permeability in various epithelial tissues

    • Affects epithelial integrity during organ morphogenesis

  • Auditory system development:

    • Evidence from human studies indicates marveld2 mutations can cause hearing loss, suggesting a conserved role in auditory system development

    • Likely involved in maintaining ion homeostasis in the inner ear

  • Developmental timeline:

    • Expression begins during gastrulation

    • Increases during neurulation and organogenesis

    • Becomes restricted to specific epithelial tissues in later development

  • Tissue distribution:

    • Primarily expressed in epithelial tissues with tight junctions

    • Particularly important in sensory epithelia

    • Also found in developing neural tissues

The transparency of Xenopus tadpoles makes this model particularly valuable for studying the spatiotemporal expression patterns and developmental functions of Marveld2 .

How can Xenopus tropicalis Marveld2 serve as a model for human MARVELD2-related disorders?

Xenopus tropicalis Marveld2 offers a sophisticated model for studying human MARVELD2-related disorders due to several key advantages:

  • Genetic conservation:

    • High synteny between Xenopus tropicalis and human genomes

    • Conservation of functional domains between species

    • Similar exon-intron organization facilitating the study of splicing mutations

  • Disease modeling approach:

    • Introduction of specific mutations identified in human patients with MARVELD2-related disorders

    • For example, the c.1331+1G>A mutation associated with nonsyndromic hearing loss can be replicated

    • Mosaic genome editing allows generation of highly penetrant and low latency disease models

  • Phenotypic analysis pipeline:

    • Histological examination of affected tissues

    • Immunohistochemical evaluation to assess protein localization

    • Functional assays to measure epithelial barrier integrity

    • Behavioral tests to assess auditory function

  • Comparative analysis with human data:

    • Correlation between genotype and phenotype across species

    • Validation of pathogenic mechanisms in a vertebrate model

Human MARVELD2 MutationXenopus Model MethodExpected PhenotypeAnalysis Technique
c.1331+1G>A (splice site)CRISPR/Cas9 gene editingHearing deficits, altered paracellular permeabilityHistology, electrophysiology, barrier assays
Truncating mutationsPremature stop codon introductionEpithelial barrier defectsImmunohistochemistry, permeability assays
Missense mutationsPoint mutation knock-inVariable depending on domain affectedProtein localization, junction assembly assays

This approach provides a versatile platform for understanding molecular mechanisms underlying MARVELD2-related human disorders and testing potential therapeutic interventions .

What are the challenges and solutions in analyzing splice site mutations in Xenopus tropicalis Marveld2?

Analyzing splice site mutations in Xenopus tropicalis Marveld2 presents several challenges that require specialized methodological approaches:

  • Challenges in splice mutation analysis:

    • Accurately predicting effects on mRNA processing

    • Determining the ratio of correctly vs. incorrectly spliced transcripts

    • Assessing tissue-specific splicing effects

    • Correlating splicing alterations with phenotypic outcomes

  • Methodological solutions:

    • RNA extraction protocols:

      • Use TRIzol or similar reagents for high-quality RNA isolation

      • Extract RNA from specific tissues to detect tissue-specific effects

      • Implement rapid extraction to minimize RNA degradation

    • Transcript analysis techniques:

      • RT-PCR with primers spanning exon junctions

      • Quantitative RT-PCR to measure relative abundance of transcript variants

      • Next-generation sequencing for comprehensive transcriptome analysis

      • Minigene assays to validate specific splicing alterations

  • Case study approach:

    • The c.1331+1G>A mutation in MARVELD2 affects a splice donor site

    • Similar mutations can be introduced in Xenopus tropicalis using CRISPR/Cas9

    • Analysis would include:

      • Extraction of RNA from relevant tissues

      • RT-PCR with primers flanking the affected exon

      • Sequencing of RT-PCR products to identify aberrant splice products

      • Quantification of normal vs. aberrant transcripts

  • Validation strategies:

    • Western blot analysis to confirm protein size alterations

    • Immunofluorescence to assess protein localization

    • Functional assays to determine the impact on tight junction formation

This systematic approach allows researchers to thoroughly characterize the molecular consequences of splice site mutations in Xenopus tropicalis Marveld2 and their functional impacts.

How can high-throughput approaches be optimized for studying Marveld2 protein interactions in Xenopus tropicalis?

High-throughput approaches for studying Marveld2 protein interactions in Xenopus tropicalis require specialized optimization strategies:

  • Protein-protein interaction screening:

    • Yeast two-hybrid system optimization:

      • Use the full-length or domain-specific constructs of Marveld2

      • Screen against Xenopus tropicalis cDNA libraries from relevant tissues

      • Validate interactions with co-immunoprecipitation

    • Affinity purification-mass spectrometry (AP-MS):

      • Express His-tagged Marveld2 in Xenopus tissues or cell lines

      • Optimize purification conditions using Tris/PBS-based buffers

      • Analyze interacting partners by MS/MS

      • Classify interactions based on cellular compartments and functions

  • CRISPR-based interaction screens:

    • Generate a library of sgRNAs targeting potential interactors

    • Introduce these into Marveld2-reporter Xenopus tropicalis embryos

    • Identify genetic interactions based on altered reporter expression

    • Validate top hits with individual knockouts

  • Interactome analysis pipeline:

    • Bioinformatic prediction of interaction networks

    • Experimental validation of key interactions

    • Functional classification of interacting partners

    • Cross-species comparison with human MARVELD2 interactome

  • Membrane protein interaction considerations:

    • Optimize detergents for membrane protein extraction (e.g., n-dodecyl-β-D-maltoside)

    • Use proximity labeling approaches (BioID, APEX) for transient interactions

    • Implement split-GFP systems for in vivo interaction validation

This comprehensive approach enables researchers to decipher the complex interaction network of Marveld2 in Xenopus tropicalis, providing insights into its molecular functions and potential roles in disease processes.

What are the most effective genomic engineering strategies for studying Marveld2 function in Xenopus tropicalis?

Advanced genomic engineering approaches offer powerful tools for dissecting Marveld2 function in Xenopus tropicalis:

  • CRISPR/Cas9 optimization strategies:

    • Knockout approach:

      • Design sgRNAs targeting early exons or conserved domains

      • Implement multiplexed sgRNA delivery for increased efficiency

      • Use Cas9 nickase approach to reduce off-target effects

      • Optimize microinjection parameters (concentration, timing, location)

    • Knock-in approach:

      • Design specific homology-directed repair templates

      • Introduce reporter genes or epitope tags for tracking expression

      • Create point mutations mimicking human disease variants

      • Implement conditional alleles for temporal control

  • Tissue-specific manipulation:

    • Use tissue-specific promoters to drive Cas9 expression

    • Implement inducible CRISPR systems for temporal control

    • Target mosaic genome editing to specific tissues or developmental stages

  • Phenotypic analysis pipeline:

    • Histological examination to assess tissue architecture

    • Immunohistochemical evaluation for protein localization

    • Functional assays to measure epithelial barrier integrity

    • Behavioral tests to assess sensory functions

  • Comparative genomic approach:

    • Analyze conservation of regulatory elements across species

    • Identify conserved binding sites for transcription factors

    • Compare phenotypes with other model organisms and human data

Table: Genomic Engineering Approaches for Marveld2 Analysis

TechniqueApplicationAdvantagesConsiderations
CRISPR/Cas9 knockoutLoss-of-function analysisSimple design, high efficiencyPotential compensation by related genes
CRISPR/Cas9 knock-inIntroduction of specific mutationsPrecise modeling of human variantsLower efficiency than knockout
Conditional knockoutTemporal/spatial function analysisAvoids early lethality, tissue-specificMore complex design and validation
Transcriptional modulation (CRISPRa/i)Gene expression studiesMaintains genome integrityVariable efficiency across targets

These genomic engineering strategies, combined with the unique advantages of Xenopus tropicalis as a model organism, provide powerful tools for understanding Marveld2 function in development and disease .

What emerging technologies will advance Marveld2 research in Xenopus tropicalis?

Several cutting-edge technologies are poised to revolutionize Marveld2 research in Xenopus tropicalis:

  • Single-cell transcriptomics and proteomics:

    • Mapping Marveld2 expression at single-cell resolution

    • Identifying cell type-specific interaction partners

    • Characterizing the effects of Marveld2 mutations on global gene expression

  • Advanced imaging techniques:

    • Super-resolution microscopy for detailed protein localization

    • Live imaging in transparent tadpoles

    • Correlative light and electron microscopy to visualize tight junction ultrastructure

  • Organ-on-chip and ex vivo culture systems:

    • Maintaining Xenopus tropicalis tissue explants with controlled manipulation

    • Studying barrier function in epithelial monolayers

    • Testing pharmacological modulators of Marveld2 function

  • Comparative multi-omics approaches:

    • Integration of genomic, transcriptomic, and proteomic data

    • Cross-species comparison between Xenopus, zebrafish, and human data

    • Systems biology modeling of tight junction assembly and function

These emerging technologies will provide unprecedented insights into Marveld2 biology and its implications for human health and disease .

How can Xenopus tropicalis Marveld2 research contribute to therapeutic development?

Research on Xenopus tropicalis Marveld2 has significant potential to inform therapeutic development for human disorders:

  • Drug discovery applications:

    • Screening compounds that modulate tight junction assembly or function

    • Identifying molecules that can rescue specific Marveld2 mutations

    • Testing gene therapy approaches using Xenopus tropicalis models

  • Translational research pipeline:

    • Validating pathogenic mechanisms of human MARVELD2 mutations

    • Establishing phenotype-genotype correlations for clinical prediction

    • Developing biomarkers for MARVELD2-related disorders

  • Precision medicine approaches:

    • Testing mutation-specific therapies in Xenopus models

    • Evaluating personalized treatment strategies

    • Developing combinatorial approaches targeting multiple pathway components

  • Interdisciplinary collaborations:

    • Combining expertise in developmental biology, genetics, and clinical research

    • Leveraging high-throughput screening capabilities

    • Integrating computational modeling with experimental validation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.