Recombinant Xenopus tropicalis Metal transporter CNNM4 (cnnm4)

Shipped with Ice Packs
In Stock

Description

Functional Role in Magnesium Transport

CNNM4 facilitates basolateral Mg²⁺ extrusion in epithelial cells, critical for systemic Mg²⁺ homeostasis:

  • Mechanism: Exchanges intracellular Mg²⁺ with extracellular Na⁺, driving transcellular Mg²⁺ absorption .

  • Regulation: Mg²⁺ binding to the Bateman module induces conformational shifts, while ATP binding enhances cooperativity with Mg²⁺ .

Table 2: Functional Assays for Recombinant CNNM4

ApplicationMethod/Outcome
Mg²⁺ Transport AssayNMR titration shows weak Mg²⁺ binding (K<sub>D</sub> >1 mM)
ATP InteractionCo-titration with Mg²⁺ stabilizes the "flat" conformation of CBS motifs
Dimerization AnalysisSEC-MALS and SAXS confirm Bateman-cNMP domain cooperativity

Pathological Relevance

Mutations in CNNM4 are linked to Jalili syndrome, characterized by amelogenesis imperfecta and cone-rod dystrophy:

  • Disease Models: CNNM4-knockout mice exhibit defective enamel formation and hypomagnesemia .

  • Functional Impact: Missense mutations (e.g., F631A) disrupt dimerization and Mg²⁺ extrusion .

Production and Purification

Recombinant CNNM4 is produced in heterologous systems for biochemical studies:

  • Expression Systems: Cell-free, E. coli, or mammalian systems yield functionally active protein .

  • Tagging: GST or His tags facilitate purification and detection .

Research Applications

  • Drug Development: Structural models guide inhibitors targeting Mg²⁺-ATP binding sites .

  • Disease Studies: Used to analyze Jalili syndrome mutations and Mg²⁺ dysregulation .

  • Biophysical Studies: SAXS and NMR resolve conformational dynamics .

Limitations and Future Directions

  • Low ATP Affinity: Intrinsic electrostatic repulsion in the Bateman module complicates nucleotide-binding studies .

  • Unstructured C-tail: Its role in Mg²⁺ transport remains unresolved .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will prepare accordingly to meet your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipment, please communicate with us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize development of the specified tag.
Synonyms
cnnm4; acdp4; Metal transporter CNNM4; Ancient conserved domain-containing protein 4; Cyclin-M4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-769
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
cnnm4
Target Protein Sequence
MAASAGCYYGVLGCALSLLLLPPLSRCAARTDSPLPEELPLILGFRLERSDRHAALSPDG ELEVVEGSRLELRVYGLHLREDSGHILAFTEYSPGSQDNRSCLEDSRDLVLTRLNVSDDG FGAAGAAIVRLDVLPLRKSQSSRVYVLCTSRGPGLPWKLHTGPDGRLRVLEEEKPLLPIW LQACIIAVLLTLSGIFSGLNLGLMALDPMELRVVQRCGTEKEKRYASKIEPVRRKGNYLL CSLLLGNVLVNTTLTALLDELIGSGLAAVLASTTGIVVLGEIVPQALCSRHGLAVGANTL WLTRIFMLLTFPVAYPVSRLLDCALGQEIGTVYNREKLLEMLKVTEPYSGIVREEMNIIQ GALELRTKTVEDVMTKVEDCFMLPSDAVLDFNTMSSIMESGYTRIPVYENERSNIVDILY VKDLAFVDPDDCTPLSTITRFYSHPLHFVFSDTKLDAVLEEFKKGKSHLAIVQKVNSEGE GDPFYEVMGLVTLEDVIEEIIKSEILDESDLYTDNRSKKRVKRRQDRKDFSVFKDADNEL RVKISPQLLLAAHRFLSTEVPLFAPALVSEKTLLRLLKYPDVVQELHFNEDDKKASENFL YQRSKIADYFILILQGKVEVEAGKENMKFESGAFSYYGVMAINTPSAAELRSPSHMSSLN RSISLSCHERSDSISSTISGSNTQLSAQAQYMADFSVRALGDLQFVKITREQYQGALMSS RLDSSPQSPEGGTRKPDSTLSERSEVLEDETTSLLNQRNSQHSLQHNAV
Uniprot No.

Target Background

Function
This protein is a probable metal transporter.
Database Links
Protein Families
ACDP family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the functional role of CNNM4 in Xenopus tropicalis?

CNNM4 functions as a metal ion transporter in Xenopus tropicalis, particularly involved in magnesium (Mg2+) transport across cellular membranes. The protein contains multiple functional domains including a Bateman module and a cyclic nucleotide binding-like domain (cNMP), which are involved in sensing and responding to changes in intracellular Mg2+ concentrations . Research indicates that CNNM4 plays a critical role in maintaining metal ion homeostasis in various tissues. The Bateman module forms two main clefts, where one can accommodate ATP despite having an unusually acidic surface, which explains the low nucleotide affinity that increases when Mg2+ is present for charge compensation . In Xenopus tropicalis, which serves as an important model organism for vertebrate development, CNNM4 likely participates in developmental processes that require precise regulation of metal ion concentrations. Mutations in human CNNM4 cause cone-rod dystrophy and amelogenesis imperfecta, suggesting its importance in eye and tooth development .

What is the relationship between CNNM2 and CNNM4 in Xenopus tropicalis?

CNNM2 and CNNM4 are members of the same protein family (CNNM family) in Xenopus tropicalis, sharing structural similarities and functional properties related to metal ion transport. According to gene annotations, CNNM4 is sometimes listed as a synonym for CNNM2 (acdp4) , suggesting potential overlapping functions or historical confusion in nomenclature. Both proteins contain conserved domains such as the Bateman module and are involved in magnesium transport. While they share significant homology, they likely have distinct tissue expression patterns and potentially different affinities for metal ions or regulatory mechanisms.

The structural features of both proteins include a Bateman module that forms S1 and S2 clefts involved in nucleotide binding and Mg2+ sensing, as well as a cyclic nucleotide binding-like domain (cNMP) that, despite its name, does not actually bind cyclic nucleotides . The cNMP domain plays an important role in stabilizing protein dimers and restricting conformational changes induced by Mg2+ binding to the Bateman module. Researchers working with either protein should carefully verify gene/protein identifiers to ensure they are studying their specific protein of interest.

What expression systems are recommended for producing recombinant Xenopus tropicalis CNNM4?

E. coli expression systems have been successfully used for producing recombinant CNNM4 domains for structural and functional studies. For the expression of CNNM4 domains, the BL21(DE3) strain has proven effective when coupled with appropriate expression vectors . For isotope labeling (such as 15N-enrichment for NMR studies), modified auto-induction media or M9 minimal media supplemented with 15NH4Cl can be used .

A typical protocol involves growing cells to an OD600 of 0.6 in LB media containing 0.1 mg/mL ampicillin, then concentrating threefold into M9 media with 15NH4Cl plus 0.2% glucose for producing 15N-labeled protein, equilibrating at 20°C for 30 minutes before overnight induction with 0.5 mM IPTG at 20°C . The protein can be purified using affinity chromatography (e.g., His-tag purification) followed by size exclusion chromatography. It's important to avoid metalloprotease inhibitors like EDTA during purification if subsequent metal binding studies are planned, as these chelators could interfere with divalent cation binding . For full-length membrane-spanning CNNM4, mammalian or insect cell expression systems might be more suitable to ensure proper folding and post-translational modifications.

How does the structure of CNNM4's intracellular domains contribute to its function in metal ion transport?

The intracellular region of CNNM4 consists of two major domains: the Bateman module and the cyclic nucleotide binding-like domain (cNMP). These domains work together to regulate metal ion transport, particularly Mg2+. The Bateman module forms two main clefts (S1 and S2), where S2 can accommodate ATP despite having an unusually acidic surface . This electrostatic repulsion between negatively charged residues in S2 and the ATP polyphosphate chain explains the low nucleotide affinity and its increase when Mg2+ is present for charge compensation .

The cNMP domain, despite its name, is unable to bind cyclic nucleotides due to several structural features: (1) an unusually long loop connecting strands β6 and β7 in the phosphate binding cassette; (2) an abrupt turn of the polypeptide chain at residues 601-603 that blocks the space needed for cyclic nucleotide binding; (3) absence of conserved residues typically involved in cyclic nucleotide binding; and (4) presence of bulky residues forming a hydrophobic pocket that sterically hinders nucleoside binding . This has been confirmed through isothermal titration calorimetry (ITC) and NMR studies showing no binding of cAMP or cGMP to the cNMP domain .

What are the key considerations when designing CRISPR/Cas9 knockout or knockin experiments for CNNM4 in Xenopus tropicalis?

When designing CRISPR/Cas9 experiments for CNNM4 in Xenopus tropicalis, several key considerations should be addressed:

  • Guide RNA Design:

    • Target conserved exons or functional domains (like the Bateman module or transmembrane regions)

    • Check for off-target effects using Xenopus tropicalis genome databases

    • Design multiple gRNAs targeting different regions to increase knockout efficiency

    • For knockins, design homology arms of appropriate length (typically 500-1000 bp)

  • Delivery Method:

    • Microinjection into one-cell or two-cell stage embryos is most common

    • Titrate Cas9 protein and gRNA concentrations to minimize toxicity while maintaining editing efficiency

    • Consider using Cas9 protein rather than mRNA for more immediate editing

  • Phenotypic Analysis:

    • Based on human studies, examine eye development (potential cone-rod dystrophy phenotypes)

    • Look for tooth development abnormalities (amelogenesis imperfecta)

    • Assess magnesium homeostasis and other ion transport functions

    • Consider using F0 mosaic animals for initial screening, but establish stable lines for detailed analysis

  • Validation Strategies:

    • PCR and sequencing to confirm genomic modifications

    • Western blotting to verify protein knockout

    • qRT-PCR to assess mRNA levels and potential compensatory upregulation of other CNNM family members

    • Rescue experiments by introducing wild-type CNNM4 to confirm specificity of phenotypes

  • Xenopus-Specific Considerations:

    • Leverage the high number of embryos (up to 9000 from a single mating) for statistical power

    • Use the diploid nature of X. tropicalis (as opposed to the tetraploid X. laevis) for cleaner genetic modifications

    • Consider the synteny between X. tropicalis and amniote genomes for translational relevance

What methods can be used to investigate the interaction between CNNM4 and PRL phosphatases in Xenopus tropicalis?

The interaction between CNNM4 and PRL (Phosphatase of Regenerating Liver) phosphatases is critical, as PRL gets inhibited by CNNM binding and, conversely, inhibits CNNM4's activity in Mg2+ transport . This interaction can be investigated using several approaches:

  • Biochemical Interaction Studies:

    • Co-immunoprecipitation (Co-IP) of endogenous or tagged proteins from Xenopus tropicalis tissues or transfected cells

    • GST pull-down assays using recombinant proteins

    • Surface plasmon resonance (SPR) or biolayer interferometry (BLI) to measure binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic parameters of the interaction

  • Structural Studies:

    • X-ray crystallography of CNNM4-PRL complexes to determine the atomic details of the interaction

    • Cryo-electron microscopy for larger complexes

    • Hydrogen/deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • NMR spectroscopy to identify binding regions in solution, particularly using 15N-labeled constructs

  • Cellular Localization Studies:

    • Fluorescence microscopy with fluorescently tagged proteins to visualize co-localization

    • Proximity ligation assay (PLA) to detect protein interactions in situ

    • FRET or BiFC to confirm direct interaction in living cells

  • Functional Studies:

    • Mg2+ transport assays in the presence/absence of PRL phosphatases

    • Phosphatase activity assays of PRL in the presence/absence of CNNM4

    • Mutagenesis of key residues in the interaction interface to disrupt binding

    • Competition assays with peptides derived from interaction interfaces

  • In vivo Studies:

    • Co-expression or knockdown studies to examine phenotypic consequences

    • Genetic interaction studies using partial knockdowns of both genes

    • Xenopus embryo manipulations to test developmental consequences of disrupting the interaction

Researchers can generate a structural model of the CNNM4-PRL complex based on existing crystal structures, similar to the approach used to model the relative orientation of CNNM4's intracellular domains . This model can guide the design of mutations to disrupt specific interaction points for functional validation.

What are the optimal conditions for expressing and purifying Xenopus tropicalis CNNM4 for structural studies?

Based on published protocols for CNNM4 domains, the following optimized conditions are recommended for expression and purification:

  • Expression System:

    • E. coli BL21(DE3) for individual domains (Bateman module, cNMP domain)

    • Consider insect cell systems (Sf9, High Five) for full-length protein including transmembrane regions

  • Expression Conditions:

    • For unlabeled protein: LB media with ampicillin (0.1 mg/mL)

    • For isotope-labeled protein: M9 minimal media with 15NH4Cl (and 13C-glucose for double labeling)

    • Induction with 0.5 mM IPTG at lower temperature (20°C) overnight for better folding

    • Consider auto-induction protocols for higher yield, as used for 15N-enriched CNNM4 constructs

  • Cell Lysis:

    • Sonication in buffer containing 25 mM HEPES pH 7.4, 400 mM NaCl, 20 mM imidazole, 1 μM β-mercaptoethanol, protease inhibitors (0.1 mM PMSF, 1 mM benzamidine), and DNase

  • Purification Strategy:

    • Initial capture: Immobilized metal affinity chromatography (IMAC) using His-tagged constructs on a HisTrap FF crude column

    • Intermediate purification: Size exclusion chromatography (HiLoad 16/60 Superdex-75 or similar)

    • Consider ion exchange chromatography as an additional step if higher purity is needed

    • Tag removal: TEV or PreScission protease cleavage followed by reverse IMAC

  • Buffer Considerations:

    • Avoid EDTA when studying metal binding properties

    • Final buffer: 150 mM HEPES pH 7.4, 100 mM NaCl, 1 mM β-mercaptoethanol

    • Include 0.2% NaN3 for longer storage

    • For crystallization, consider buffer screening to identify optimal conditions

  • Special Considerations:

    • The cNMP domain with C-terminal tail may be more challenging to crystallize; consider removing the unstructured C-tail

    • For the Bateman module, ATP and Mg2+ co-binding increases stability

    • Concentrations of 30-40 mg/mL are achievable for concentrated samples needed for crystallization

What analytical techniques are most effective for characterizing the interactions between CNNM4 and metal ions?

Multiple analytical techniques can be employed to characterize CNNM4-metal ion interactions, each providing different types of information:

For comprehensive characterization, researchers should combine multiple techniques. For example, NMR titration studies have shown that CNNM4's Bateman module interacts weakly with free Mg2+ ions, with line broadening and signal splitting indicating slow exchange between free and Mg2+-bound forms with significant conformational heterogeneity .

How can researchers investigate CNNM4's metal transport activity in Xenopus tropicalis models?

To investigate CNNM4's metal transport activity in Xenopus tropicalis models, researchers should consider a multi-faceted experimental approach:

  • In Vitro Transport Assays:

    • Reconstitute purified CNNM4 into liposomes or proteoliposomes

    • Use radioisotopes (e.g., 28Mg2+) or fluorescent metal indicators to track transport

    • Perform flux measurements under various conditions (different pH, membrane potential, ion gradients)

    • Compare transport kinetics of wild-type vs. mutant CNNM4

  • Cellular Assays in Xenopus Oocytes:

    • Express CNNM4 in Xenopus oocytes via mRNA injection

    • Measure ion currents using two-electrode voltage clamp (TEVC)

    • Use Mg2+-sensitive dyes like Mag-Fura-2 to monitor intracellular Mg2+ levels

    • Perform ion substitution experiments to determine selectivity

  • Embryonic Studies:

    • Create transgenic Xenopus tropicalis expressing fluorescent metal sensors

    • Manipulate CNNM4 expression (knockdown, overexpression, mutation)

    • Image metal ion distribution in developing embryos

    • Correlate metal transport activity with developmental phenotypes

    • Take advantage of X. tropicalis' diploid genome (unlike the tetraploid X. laevis) for cleaner genetic analysis

  • Tissue-Specific Analysis:

    • Focus on tissues known to express CNNM4 highly (based on in situ data)

    • Pay particular attention to eye and tooth development, given the human diseases associated with CNNM4 mutations

    • Isolate tissues from normal and CNNM4-manipulated animals

    • Measure metal content using ICP-MS or other sensitive analytical methods

    • Correlate with histological changes in the tissues

  • Regulatory Mechanisms:

    • Investigate how CNNM4 transport is regulated by:

      • Intracellular Mg2+ levels

      • ATP binding to the Bateman module

      • Interaction with PRL phosphatases, which are known to inhibit CNNM4's activity in Mg2+ transport

      • Post-translational modifications

The study of metal transport by CNNM4 in Xenopus tropicalis combines the advantages of a genetically tractable model system with the ability to perform robust embryological, molecular, and biochemical assays . The production of up to 9000 embryos from a single mating provides sufficient material for comprehensive analyses .

How should researchers interpret contradictory findings about CNNM4 function across different model systems?

When faced with contradictory findings about CNNM4 function across different model systems, researchers should implement a systematic approach to reconcile discrepancies:

The advantages of Xenopus tropicalis as a model system include its diploid genome (versus the tetraploid X. laevis), which shows robust synteny with amniote genomes, simplifying orthology assignment, functional analysis, and identification of noncoding regulatory elements . This makes it particularly valuable for comparative studies with human CNNM4.

What bioinformatic tools and databases are most useful for analyzing Xenopus tropicalis CNNM4 in comparative studies?

For comprehensive bioinformatic analysis of Xenopus tropicalis CNNM4 in comparative studies, researchers should utilize a combination of specialized tools and databases:

  • Sequence Analysis and Annotation:

  • Evolutionary Analysis Tools:

    • MEGA X: For phylogenetic tree construction and molecular evolution analysis

    • PAML: For detection of positive selection

    • ConSurf: For identifying functionally important regions based on evolutionary conservation

    • Clustal Omega/MUSCLE: For multiple sequence alignments of CNNM family proteins

  • Structural Analysis Tools:

    • SWISS-MODEL/I-TASSER: For homology modeling of Xenopus CNNM4 based on available structures

    • PyMOL/UCSF Chimera: For visualization and analysis of structural features, particularly the Bateman module and cNMP domain structures

    • PredictProtein/PSIPRED: For secondary structure prediction

    • TMHMM/Phobius: For transmembrane domain prediction

  • Expression Analysis Resources:

    • Expression Atlas: For comparing expression patterns across tissues and species

    • Xenopus laevis/tropicalis Development EST Database: For stage-specific expression data

    • Single Cell Expression Atlas: For cell-type specific expression patterns

    • GEO Datasets: For transcriptomic data from various experiments

  • Xenopus-Specific Resources:

    • Xenopus tropicalis Genome Project: Complete genome and annotation

    • Xenopus Genome Resource: Community-curated genomic information

    • Xenopus Model Organism Database: For phenotype and mutant information

    • Xenbase Gene Expression Database: For spatiotemporal expression patterns

When performing comparative analyses, it's important to leverage the advantage of X. tropicalis' compact diploid genome (~1.5×109 bp), which is one of the smallest tetrapod genomes, about the same size as zebrafish, and shows robust synteny with those of amniotes . This synteny simplifies orthology assignment and functional analysis.

What emerging technologies could advance our understanding of CNNM4 structure and function?

Several cutting-edge technologies hold promise for advancing our understanding of CNNM4 structure and function:

  • Advanced Structural Biology Approaches:

    • Cryo-Electron Microscopy (Cryo-EM): Enables visualization of full-length CNNM4 in native conformations without crystallization, overcoming limitations of current crystal structures that only capture individual domains

    • Single-Particle Analysis: For determining structures of different conformational states

    • Integrative Structural Biology: Combining multiple techniques (X-ray, NMR, SAXS, Cryo-EM) for comprehensive structural models

    • Time-Resolved X-ray Crystallography/Spectroscopy: For capturing transient states during the transport cycle

  • Single-Molecule Technologies:

    • Single-Molecule FRET: To monitor conformational changes during transport cycles

    • High-Speed AFM: For visualizing conformational dynamics in real-time

    • Patch-Clamp Fluorometry: Combining electrophysiology with fluorescence for correlating structural changes with function

    • Optical Tweezers: For measuring forces generated during conformational changes

  • Advanced Imaging Technologies:

    • Super-Resolution Microscopy (STORM, PALM, STED): For visualizing CNNM4 distribution and dynamics at nanometer resolution

    • Lattice Light-Sheet Microscopy: For long-term, non-invasive imaging of CNNM4 dynamics in living tissues

    • Correlative Light and Electron Microscopy (CLEM): For linking functional observations with ultrastructural details

  • Genome Engineering and Gene Editing:

    • CRISPR-Cas9 Base Editing: For precise single nucleotide modifications without double-strand breaks

    • Prime Editing: For targeted insertions, deletions, and all possible base-to-base conversions

    • CRISPR Activation/Inhibition (CRISPRa/CRISPRi): For precise modulation of CNNM4 expression

    • CRISPR Knock-In of Fluorescent Tags: For endogenous labeling and visualization

  • Specialized Sensors and Probes:

    • Genetically Encoded Metal Ion Sensors: For real-time visualization of ion fluxes in living cells/organisms

    • Engineered CNNM4 Variants with Built-in Sensors: For directly monitoring conformational changes

    • Nanobodies and Aptamers: For targeting specific conformational states of CNNM4

    • Proximity Labeling Approaches (BioID, APEX): For mapping the spatial environment of CNNM4 in living cells

These technologies could help resolve fundamental questions about CNNM4, including whether it functions as a direct transporter or a transport regulator, and how its structure changes during the transport cycle. The high-throughput capabilities of Xenopus tropicalis as a model system, with its ability to produce up to 9000 embryos from a single mating , make it particularly well-suited for implementing these advanced technologies at scale.

How might findings from Xenopus tropicalis CNNM4 research translate to human health applications?

Research on Xenopus tropicalis CNNM4 has significant translational potential for human health applications:

  • Understanding Disease Mechanisms:

    • Retinal Disorders: CNNM4 mutations cause cone-rod dystrophy in humans; Xenopus models can elucidate pathogenic mechanisms

    • Dental Abnormalities: Insights into CNNM4's role in amelogenesis imperfecta could inform treatment strategies

    • Magnesium-Related Disorders: Findings may apply to other conditions involving magnesium dysregulation

    • Cancer Biology: Given the interaction between CNNM4 and oncogenic PRL phosphatases , Xenopus models may reveal therapeutic targets

  • Therapeutic Development Pathways:

    • Drug Discovery: Identify compounds that modulate CNNM4 activity for treating associated disorders

    • Gene Therapy Approaches: Test delivery methods and efficacy in Xenopus before human applications

    • Small Molecule Screening: Develop assays based on Xenopus CNNM4 for high-throughput screening

    • Protein-Protein Interaction Inhibitors: Target the CNNM4-PRL interface to restore normal function

  • Diagnostic Applications:

    • Biomarker Development: Identify downstream effects of CNNM4 dysfunction that could serve as diagnostic markers

    • Genetic Testing Refinement: Better understanding of structure-function relationships can improve variant interpretation

    • Functional Assays: Develop assays to test the impact of novel CNNM4 variants found in patients

  • Translational Research Framework:

    • Comparative Analysis of CNNM4 Function: Across species to identify conserved mechanisms

    • Xenopus-to-Human Translation: Systematic approach for validating findings in human cells/tissues

    • Phenotypic Correlation: Map phenotypes in Xenopus to human pathologies

    • Developmental Timing Alignment: Between Xenopus and human developmental stages

By leveraging the unique advantages of Xenopus tropicalis (large embryo numbers, external development, diploid genome with strong synteny to humans) , researchers can efficiently test hypotheses with direct human health relevance. The connection between abnormal ion homeostasis and diseases like cone-rod dystrophy and amelogenesis imperfecta provides a clear pathway for translational research focused on modulating CNNM4 function or its downstream effects.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.