Recombinant Xenopus tropicalis Mitochondrial import inner membrane translocase subunit Tim22 (timm22)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Function

The recombinant Xenopus tropicalis Tim22 (timm22) is a mitochondrial protein critical for the import and insertion of multi-pass transmembrane proteins into the inner mitochondrial membrane (IMM). It forms the core of the TIM22 complex, a voltage-dependent channel that utilizes the mitochondrial membrane potential (Δψ) to drive protein translocation . This process is essential for mitochondrial biogenesis and function, as it ensures the proper localization of carrier proteins (e.g., ADP/ATP translocases) and other polytopic IMM proteins .

Key Functional Properties:

PropertyDescriptionSource
Role in TIM22 ComplexCentral channel subunit mediating membrane potential-dependent protein insertion
Substrate SpecificityTargets proteins with internal mitochondrial targeting signals
Interacting PartnersTIM9-TIM10 complex, TIM54, TIM18, Sdh3 (in yeast)
Disease AssociationMutations linked to mitochondrial myopathies and neurological disorders

TIM22 Complex Assembly and Function

Studies in budding yeast and mammalian systems highlight the importance of Tim22’s conserved regions:

  • IMS and TM4 Domains: Essential for binding Tim54, Tim18, and Sdh3, stabilizing the TIM22 channel .

  • TM1-TM2 Regions: Critical for Tim18 interaction; TM3 specifically required for Sdh3 binding .

  • Disease Models: Mutations in TIM22-associated proteins (e.g., AGK, TIM29) cause clogging of import channels, leading to mitochondrial dysfunction .

Pathway Interactions and Regulatory Networks

Tim22 operates within interconnected mitochondrial import pathways:

PathwayKey PartnersFunctionSource
Mitochondrial Protein ImportTOMM, TIM23, MIASequential targeting and translocation of nuclear-encoded proteins
Protein Quality ControlYME1L1 (AAA protease)Degradation of stalled substrates at TIM22

Production and Experimental Use

Recombinant Xenopus tropicalis Tim22 is synthesized via cell-free expression or heterologous systems (e.g., E. coli, mammalian cells). Applications include:

  • Structural Studies: Mapping conserved regions critical for channel assembly .

  • Functional Assays: Testing membrane potential-dependent translocation of carrier proteins .

  • Disease Modeling: Investigating TIM22-related pathologies (e.g., mitochondrial myopathies) .

Recombinant Protein Comparisons:

SpeciesHost SystemPurityApplicationsSource
Xenopus tropicalisCell-free≥85%Structural/stability studies
HumanMammalian cells≥95%Western blot, ELISA
MouseE. coli≥85%Partial protein analysis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
timm22; tim22; Mitochondrial import inner membrane translocase subunit Tim22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
timm22
Target Protein Sequence
MGGSVSPPGTGEGTLQYSLIMEHLVGDKRRPKEVIPGGLGGIPTPIKSEEQKMMERVMES CGFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKN FAIVGAMFSCTECLVESYRGKSDWKNSVISGCITGGAIGFRAGLKAGALGCGGFAAFSAV IDYYLR
Uniprot No.

Target Background

Function

Recombinant Xenopus tropicalis Mitochondrial Import Inner Membrane Translocase Subunit Tim22 (TIM22): A crucial component of the TIM22 complex, this protein facilitates the import and insertion of multi-pass transmembrane proteins into the mitochondrial inner membrane. Within the TIM22 complex, it functions as a voltage-activated and signal-gated channel, forming a twin-pore translocase that utilizes the membrane potential as an external driving force in two voltage-dependent steps.

Database Links
Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of Tim22 in mitochondrial protein import?

Tim22 serves as the central component of the mitochondrial inner membrane protein insertion machinery known as the TIM22 complex. It forms the critical insertion channel that mediates the integration of polytopic membrane proteins into the inner mitochondrial membrane . The protein plays an essential role in mitochondrial biogenesis by facilitating the proper sorting and assembly of proteins to their submitochondrial compartments. Specifically, Tim22 handles the insertion of carrier proteins and other multispanning membrane proteins that are crucial for mitochondrial function .

Methodologically, Tim22 function can be assessed through in vitro import assays where radiolabeled substrate proteins (such as Tim23) are incubated with isolated mitochondria, followed by analysis of their insertion efficiency using blue-native PAGE (BN-PAGE) and SDS-PAGE techniques .

How conserved is the Tim22 protein structure across species?

The sequence homology between Xenopus laevis and Xenopus tropicalis Tim22 would be expected to be high, though some differences may exist due to evolutionary divergence. While specific conservation data between X. tropicalis and other species is not directly provided in the search results, we can observe that certain molecular mechanisms—such as disulfide bond formation between conserved cysteines—are preserved across different organisms .

To experimentally determine conservation, researchers would perform multiple sequence alignments and phylogenetic analyses using tools like ClustalW or MUSCLE, focusing particularly on functional domains and critical residues.

What are the optimal conditions for expressing and purifying recombinant Xenopus tropicalis Tim22?

Based on successful protocols for X. laevis Tim22 , the following methodological approach is recommended for X. tropicalis Tim22:

Expression Strategy:

  • Clone the full-length coding sequence into a bacterial expression vector with an N-terminal His-tag

  • Transform into E. coli expression strains optimized for membrane proteins (e.g., C41(DE3))

  • Culture cells at 30°C until reaching OD600 ~0.6-0.8

  • Induce with IPTG at reduced temperature (18-25°C) to enhance proper folding

  • Harvest cells after 4-16 hours of induction

Purification Protocol:

  • Lyse cells in buffer containing appropriate detergents for membrane protein extraction

  • Perform affinity chromatography using Ni-NTA resin

  • Apply additional purification steps (ion exchange, size exclusion chromatography)

  • Confirm purity by SDS-PAGE (aim for >90% purity)

Storage Conditions:

  • Store in Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • For long-term storage, lyophilize or add glycerol to 50% final concentration

  • Store at -20°C/-80°C and avoid repeated freeze-thaw cycles

  • For working solutions, reconstitute in deionized sterile water to 0.1-1.0 mg/mL

These conditions would require optimization specifically for X. tropicalis Tim22 through small-scale expression trials.

How can we verify proper disulfide bond formation in recombinant Tim22?

Proper disulfide bond formation is critical for Tim22 stability and function . To verify this structural feature in recombinant X. tropicalis Tim22, employ the following methodological approaches:

  • Non-reducing vs. reducing SDS-PAGE: Compare protein migration under reducing conditions (with DTT or β-mercaptoethanol) versus non-reducing conditions. Proteins with intact disulfide bonds typically migrate faster under non-reducing conditions .

  • Mass spectrometry analysis: Perform LC-MS/MS after limited proteolysis to identify disulfide-linked peptides.

  • Thermal stability assessment: Compare the stability of wild-type Tim22 versus cysteine mutants (corresponding to C42S and C141S in yeast) at elevated temperatures (37°C). Wild-type protein with intact disulfide bonds should show greater thermal stability .

  • Functional binding assays: Test interactions with known binding partners (e.g., Tim18) through co-immunoprecipitation. Research has shown stronger interactions between oxidized Tim22 and Tim18 compared to reduced Tim22 .

  • Blue-native PAGE analysis: Compare the migration and stability of the TIM22 complex assembled with wild-type Tim22 versus cysteine mutants. Disulfide bond-deficient Tim22 forms slightly smaller complexes with altered stability properties .

What methods are most effective for studying the TIM22 complex in Xenopus tropicalis mitochondria?

To effectively study the TIM22 complex in X. tropicalis mitochondria, researchers should employ a combination of biochemical, structural, and functional approaches:

  • Mitochondrial isolation:

    • Develop X. tropicalis-specific protocols for isolating intact mitochondria from tissues or embryos

    • Preserve mitochondrial membrane integrity and respiratory function

  • Complex visualization by blue-native PAGE:

    • Solubilize mitochondria with 1% digitonin to maintain complex integrity

    • Use gradient gels (3-12% or 4-16%) for optimal resolution

    • Detect with antibodies against TIM22 complex components (Tim22, Tim54, Tim18)

    • Compare with other mitochondrial complexes (TOM40, TIM23) as controls

  • In vitro import assays:

    • Generate radiolabeled substrate proteins using in vitro transcription/translation systems

    • Incubate with isolated mitochondria under defined conditions

    • Analyze import efficiency by SDS-PAGE and assembly by BN-PAGE

    • Include controls such as CCCP to dissipate membrane potential

  • Co-immunoprecipitation studies:

    • Use antibodies against Tim22 to pull down interacting partners

    • Identify components by western blotting or mass spectrometry

    • Compare interaction profiles under different conditions (e.g., oxidizing vs. reducing)

  • Cryo-EM structural analysis:

    • Apply techniques similar to those used for human TIM22 complex

    • Determine species-specific structural features and subunit arrangements

These approaches enable comprehensive characterization of the X. tropicalis TIM22 complex composition, structure, and function.

How does the disulfide bond in Tim22 affect the stability and function of the TIM22 complex?

Based on detailed studies in yeast, the intramolecular disulfide bond in Tim22 plays critical roles in maintaining both structural integrity and functional capacity of the TIM22 complex :

Structural effects:

Functional consequences:

  • Protein exchange dynamics: Disulfide bond-deficient Tim22 shows accelerated exchange with newly imported Tim22, indicating altered complex dynamics and potentially reduced stability .

  • Substrate protein assembly: Tim22 lacking the disulfide bond demonstrates impaired ability to facilitate assembly of substrate proteins (like Tim23) into the inner membrane, particularly when handling excess substrate loads .

  • Temperature sensitivity: The structural destabilization becomes more pronounced at elevated temperatures, with significant decreases in complex levels after heat treatment .

These findings underscore the importance of this post-translational modification for both structural integrity and functional capacity of the TIM22 complex.

What are the experimental considerations for designing in vitro import assays using Tim22 as a substrate?

When designing in vitro import assays to study the import and assembly of Tim22 or other substrates via the TIM22 complex in Xenopus tropicalis mitochondria, several critical parameters must be carefully controlled:

Substrate preparation:

  • Generate radiolabeled proteins using in vitro transcription/translation systems with [35S]methionine

  • For excess substrate experiments, prepare C-terminally FLAG-tagged proteins using wheat germ extracts

  • Maintain native-like folding by avoiding denaturants during substrate handling

Mitochondrial preparation:

  • Isolate intact mitochondria maintaining membrane potential and respiratory activity

  • Use fresh preparations or store under conditions preserving import competence

  • Include appropriate buffers with energy sources (ATP, NADH)

Import conditions:

ParameterStandard ConditionsConsiderations
Temperature25-30°C37°C for studying temperature-dependent effects
Time course5, 10, 20, 40 minMultiple timepoints to monitor assembly kinetics
Energy requirementsATP + NADHControls without energy to establish specificity
Membrane potentialMaintainedCCCP as negative control to dissipate potential
Buffer compositionIsotonic with physiological pHMay require optimization for X. tropicalis

Analysis methods:

  • SDS-PAGE: Assess total import after proteinase K treatment to remove non-imported proteins

  • BN-PAGE: Monitor assembly into the TIM22 complex and detect assembly intermediates (e.g., Tim22 dimer)

  • Two-dimensional BN/SDS-PAGE: Analyze complex composition after import

  • Quantification: Use phosphorimaging for precise quantification of import/assembly efficiency

These methodological considerations ensure reliable and reproducible results when studying Tim22 import and assembly in X. tropicalis mitochondria.

How can mutations in conserved Cys residues affect Tim22 function and TIM22 complex integrity?

Mutations in conserved cysteine residues of Tim22 that prevent disulfide bond formation have profound effects on both protein and complex function, as demonstrated through site-directed mutagenesis studies in yeast :

Effects on Tim22 protein:

  • Reduced stability: Cys→Ser mutants (C42S, C141S, C42/141S) show decreased protein levels when cells are cultured at elevated temperatures (37°C) .

  • Altered conformation: The lack of disulfide bonds affects protein folding and tertiary structure.

  • Modified interaction profile: Reduced Tim22 shows weaker interactions with binding partners like Tim18 compared to oxidized Tim22 .

Effects on TIM22 complex:

  • Altered complex size: BN-PAGE analysis reveals slightly smaller TIM22 complexes in mutant mitochondria compared to wild-type .

  • Complex fragmentation: Additional smaller subcomplexes containing Tim54 appear in Cys→Ser mutants, indicating partial complex disassembly .

  • Decreased complex levels: After heat treatment (37°C), the amounts of TIM22 complex detected with antibodies against Tim22, Tim18, and Tim54 decrease significantly .

  • Accelerated subunit exchange: Assembly of wild-type Tim22 into the TIM22 complex is faster in mutant mitochondria, suggesting a more dynamic complex structure .

Functional consequences:

  • Impaired substrate protein assembly: Mutant mitochondria show defects in the assembly of multispanning inner membrane proteins like Tim23, particularly when handling excess amounts of substrate proteins .

  • Temperature sensitivity: The functional defects become more pronounced at elevated temperatures .

These findings highlight the critical role of disulfide bonds in maintaining both the structural integrity and functional capacity of the TIM22 complex.

What is currently known about the structural organization of the TIM22 complex?

Recent structural studies, particularly cryo-EM analysis of the human TIM22 complex, have provided valuable insights into its organization :

  • The TIM22 complex measures approximately 100 Å in height and 160 Å in the longest dimension of width

  • Most of the structure is located in the intermembrane space (IMS), with transmembrane segments forming the core of the complex

Subunit composition:

  • Tim22: Forms the central channel with four transmembrane segments

  • Tim29: Contributes one transmembrane segment to the complex

  • AGK (acylglycerol kinase): A component of the human complex

  • Chaperone hexamers: Two hexameric chaperones, Tim9/10a and Tim9/10a/10b, with stoichiometries of 3:3 and 2:3:1, respectively

Transmembrane arrangement:

  • Four TMs of Tim22 plus one TM of Tim29 constitute the central transmembrane element

  • The N-terminus of Tim22 faces the intermembrane space

  • One N-terminal helix of Tim29 protrudes from the core transmembrane region and lies parallel to the membrane plane on the matrix side

Topological features:

  • The N-terminus of Tim22 and the extended C-terminus of Tim29 are located in the intermembrane space

  • This organization facilitates interactions with incoming substrate proteins and chaperone complexes

While this structural information comes from the human TIM22 complex, the high conservation of mitochondrial import machinery suggests similar organization in X. tropicalis, though species-specific variations would be expected.

What are the challenges in studying Tim22 in Xenopus tropicalis compared to other model organisms?

Studying Tim22 in Xenopus tropicalis presents unique challenges compared to other model systems, requiring specialized approaches:

Genomic considerations:

  • Genome complexity differences between X. tropicalis (diploid) and X. laevis (allotetraploid), which may have gene duplications

  • Potential for different isoforms or splice variants that may be species-specific

  • Need for precise identification of the true ortholog through phylogenetic analysis

Experimental challenges:

  • Antibody specificity: Commercially available antibodies may not cross-react with X. tropicalis Tim22, requiring custom antibody production

  • Mitochondria isolation: Protocols optimized for mammalian or yeast mitochondria may require modification for X. tropicalis tissues

  • Temperature considerations: X. tropicalis' optimal physiological temperature differs from mammals, affecting experimental conditions for thermal stability assays

Developmental context:

  • The expression and function of Tim22 may vary across developmental stages in X. tropicalis

  • Studying embryonic development requires stage-specific analyses

  • Mitochondrial biogenesis during development may involve unique regulatory mechanisms

Technical limitations:

  • Fewer genetic tools compared to established models like yeast or mice

  • Limited availability of X. tropicalis-specific reagents and resources

  • Need to develop species-specific molecular biology techniques

These challenges necessitate careful experimental design and often require adaptation of protocols established in other systems to the specific biological context of X. tropicalis.

How can developmental stage-specific analysis of Tim22 be performed in Xenopus tropicalis?

To analyze Tim22 expression and function across developmental stages in X. tropicalis, researchers should employ a multi-faceted approach:

Expression profiling:

  • Temporal analysis: Perform RT-qPCR to quantify Tim22 mRNA levels across developmental stages from early cleavage through metamorphosis

  • Spatial patterns: Use in situ hybridization to visualize tissue-specific expression patterns at key developmental stages

  • Protein levels: Conduct western blotting with stage-specific embryo or tissue lysates to track protein abundance

Functional analysis:

  • Targeted knockdown: Inject antisense morpholinos or CRISPR/Cas9 components at early stages to disrupt Tim22 expression

  • Phenotypic assessment: Document developmental abnormalities, focusing on tissues with high mitochondrial requirements (muscle, nervous system, heart)

  • Rescue experiments: Co-inject wild-type vs. mutant (e.g., Cys→Ser) Tim22 mRNA to assess functional requirements

Mitochondrial development:

  • Organelle dynamics: Track mitochondrial biogenesis during development using fluorescent markers

  • Import capacity: Isolate mitochondria from different developmental stages and perform in vitro import assays

  • TIM22 complex assembly: Use BN-PAGE to monitor complex formation and composition changes throughout development

Stage-specific mitochondrial proteomics:

  • Isolate mitochondria from key developmental stages

  • Perform quantitative proteomics to identify changes in mitochondrial protein composition

  • Correlate findings with Tim22 expression and TIM22 complex assembly

This comprehensive approach would reveal the developmental regulation and stage-specific requirements for Tim22 function in X. tropicalis, providing insights into mitochondrial biogenesis during vertebrate development.

What are promising research applications for recombinant Xenopus tropicalis Tim22?

Recombinant X. tropicalis Tim22 offers multiple promising research applications that could advance our understanding of mitochondrial biology and development:

Structural biology applications:

  • Cryo-EM analysis of X. tropicalis TIM22 complex to compare with human structure

  • Crystallography of Tim22 alone or in complex with interaction partners

  • Structure-guided design of mutants to probe specific functional domains

Biochemical tools:

  • Development of Tim22-specific antibodies for immunoprecipitation and localization studies

  • Generation of tagged versions for tracking protein dynamics in vivo

  • Creation of sensor constructs to monitor Tim22 folding or complex assembly in real-time

Developmental biology research:

  • In vivo injection of labeled recombinant Tim22 to track mitochondrial import during development

  • Rescue experiments in Tim22-depleted embryos to assess structure-function relationships

  • Investigation of tissue-specific requirements for Tim22 function

Evolutionary comparative studies:

  • Functional comparison with Tim22 from X. laevis to explore evolutionary adaptations

  • Complementation studies in yeast to assess functional conservation across diverse species

  • Analysis of species-specific modifications and their impact on function

Therapeutic research applications:

  • Model mitochondrial diseases associated with TIM22 complex dysfunction

  • Screen for compounds that stabilize mutant Tim22 proteins

  • Develop tools to assess mitochondrial import defects in disease models

These diverse applications highlight the value of recombinant X. tropicalis Tim22 as both a research tool and a subject for fundamental discoveries in mitochondrial biology.

How might the disulfide bond in Tim22 be leveraged for biotechnological applications?

The disulfide bond in Tim22 represents a unique structural feature that could be exploited for various biotechnological applications:

Protein engineering applications:

  • Stability enhancement: The Tim22 disulfide bond mechanism could be adapted to improve stability of other membrane proteins for structural studies or therapeutic applications

  • Temperature-sensitive switches: Engineering disulfide bonds based on the Tim22 model could create proteins with temperature-dependent stability for biotechnological processes

  • Redox-responsive proteins: Develop engineered proteins that change conformation or activity based on redox state, similar to Tim22's interaction profile differences between oxidized and reduced states

Biotechnological tools:

  • Import efficiency reporters: Create fusion proteins incorporating the Tim22 disulfide bond region as sensors of mitochondrial import efficiency

  • Protein folding quality control: Adapt the disulfide bond formation as a marker for proper protein folding in heterologous expression systems

  • Complex assembly monitors: Develop assays based on Tim22 disulfide status to report on protein complex assembly dynamics

Therapeutic applications:

  • Stabilization of disease-associated mutants: Apply insights from Tim22 disulfide bond stability to design strategies for stabilizing disease-associated mutant proteins

  • Drug screening platforms: Create assays based on Tim22 disulfide bond formation to screen for compounds that affect protein stability or complex assembly

  • Targeted protein degradation: Engineer systems using principles from Tim22 stability regulation for controlling protein turnover

These applications would leverage fundamental insights from Tim22 disulfide bond biology to create new tools and approaches for protein engineering, biotechnology, and therapeutic development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.