Recombinant Xenopus tropicalis Mitochondrial import inner membrane translocase subunit Tim23 (timm23)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
timm23; timm23b; Mitochondrial import inner membrane translocase subunit Tim23
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
timm23
Target Protein Sequence
MDTNHPGSAGGRGGLGSIFGGGSPGYSHSDLAGVPLTGMSPLSPYLNVDPRYLVQDNDEF ILPTGANKTRGRFELAFFTIGGCCMSGAAFGAVNGLRLGFKETQNMAWSKPKNVQILNMV TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTIAAGTMTGMLYKSTGGLRGVARG GLAGLALTSAFALYNNWEHIKGSSSRLSL
Uniprot No.

Target Background

Function
Essential component of the TIM23 complex, which mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Database Links

KEGG: xtr:496463

UniGene: Str.5994

Protein Families
Tim17/Tim22/Tim23 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does Xenopus tropicalis TIMM23 compare to its homologs in other species?

Xenopus tropicalis TIMM23 shares significant structural conservation with its homologs in yeast and humans. Recent structural analysis reveals:

SpeciesSequence Identity with X. tropicalisKey Structural FeaturesEvolutionary Significance
Yeast (S. cerevisiae)~40-45%Four transmembrane domains, conserved cavity for protein translocationAncestral form with simpler architecture
Human~65-70%Four transmembrane domains, high conservation in transmembrane regionsHigher complexity with two variants (TIMM17A/B partners)

The transmembrane regions and residues forming the protein-conducting cavity are particularly well-conserved across species, highlighting their functional importance . The conservation pattern suggests that while the core translocation mechanism is preserved throughout evolution, higher eukaryotes have developed more complex regulatory mechanisms, including alternative complex assembly with different TIMM17 isoforms .

What are the optimal storage and handling conditions for recombinant X. tropicalis TIMM23?

For optimal stability and activity of recombinant X. tropicalis TIMM23:

  • Short-term storage (up to one week): Store working aliquots at 4°C

  • Long-term storage: Store at -20°C, or preferably at -80°C for extended periods

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

  • Reconstitution protocol:

    • Centrifuge vial briefly before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (recommended 50%) for long-term storage

    • Aliquot to avoid repeated freeze-thaw cycles

Important: Repeated freeze-thaw cycles significantly reduce protein activity and should be strictly avoided . When planning experiments, prepare single-use aliquots to maintain protein integrity.

What purification methods are most effective for isolating TIM23 complexes from Xenopus models?

The most effective purification strategies for isolating intact TIM23 complexes from Xenopus models involve:

  • Co-immunoprecipitation with affinity-purified antibodies:

    • Solubilize mitochondria at 1 mg/ml in mitochondrial lysis buffer (25 mM Tris-HCl, pH 7.5, 10% glycerol, 80 mM KCl, 5 mM EDTA, and 1 mM PMSF)

    • Use 1% digitonin as detergent (maintains complex integrity better than harsher detergents)

    • Incubate with antibody-conjugated beads (e.g., protein A Sepharose) for 1.5 hours at 4°C

    • Wash with lysis buffer containing 0.1% digitonin to remove non-specific interactions

  • Affinity purification using tagged TIMM23:

    • Express His-tagged or FLAG-tagged TIMM23 in the system

    • Purify using Ni-NTA or anti-FLAG affinity chromatography

    • Analyze interacting partners by SDS-PAGE and immunoblotting

For studying dynamic interactions within the TIM23 complex, site-specific photo-cross-linking using Bpa (p-benzoyl-L-phenylalanine) incorporation at strategic residues has proven particularly informative, especially for capturing transient interactions .

How does the X. tropicalis TIM23 complex assemble, and what are its key interaction partners?

The X. tropicalis TIM23 complex assembly follows a pattern similar to that observed in other vertebrates, with some species-specific interactions:

  • Core Complex Formation:

    • TIMM23 forms heterodimers with TIMM17 homologs through transmembrane domain interactions

    • This core complex creates the primary protein-conducting channel across the inner mitochondrial membrane

  • Key Interaction Partners:

    • Matrix side: TIMM44 directly interacts with the matrix-exposed loop 1 of TIMM23, serving as a scaffold for the import motor components

    • Regulatory components: PAM16, PAM17, and PAM18 associate with the complex, primarily through interactions with TIMM44 and TIMM17

    • Channel regulation: ROMO1 (reactive oxygen species modulator 1), a homolog of yeast Mgr2, interacts with both TIMM23 and TIMM17 to create a channel-like structure

The interactions between TIMM23 and its partners are dynamically regulated during protein import. Site-specific photo-cross-linking studies have identified that the N-terminal region of TIMM44 (residues 160-165) directly interacts with loop 1 of TIMM23, providing a critical anchor point for the import motor assembly .

What methodological approaches can detect subtle conformational changes in the TIM23 complex during protein translocation?

Advanced methodologies to detect conformational changes in the TIM23 complex include:

  • Site-specific photo-cross-linking:

    • Incorporate Bpa at strategic residues in TIMM23 (particularly in loop regions)

    • UV-irradiate to covalently cross-link interacting partners

    • Analyze cross-linked products by immunoblotting to identify proximity relationships

    • This approach has successfully captured dynamic interactions between TIMM23 N127 and TIMM44, revealing conformational shifts during protein translocation

  • Computational structural analysis:

    • Use AlphaFold2 multimer models to predict complex structures (particularly effective for transmembrane regions with pLDDT ≥ 70)

    • Compare inter- and intramolecular interactions using RMSD calculations

    • Analyze surface hydrophobicity and electrostatic potential to identify functional regions

    • This approach has revealed conservation patterns and functional surfaces between species

  • Electron microscopy coupled with functional assays:

    • Combine cryo-EM structural data with site-directed mutagenesis

    • Mutate key residues (e.g., positions 137-139 in loop 1) and assess functional consequences

    • Correlate structural perturbations with changes in protein import efficiency

These methodologies provide complementary insights into the dynamic structural changes occurring during protein translocation.

How can X. tropicalis TIMM23 be used as a model for understanding human mitochondrial protein import diseases?

X. tropicalis TIMM23 serves as an excellent model for understanding human mitochondrial protein import pathologies due to:

  • Evolutionary conservation: High structural similarity between X. tropicalis and human TIMM23 allows for translational insights

  • Experimental advantages:

    • X. tropicalis as a diploid organism offers simpler genetic manipulation compared to X. laevis

    • The maternal deposition of mitochondria makes it ideal for studying mitochondrial inheritance patterns

    • The transparency of embryos enables visualization of mitochondrial dynamics in vivo

  • Methodological approaches:

    • Transgenic models: Generate TIMM23 mutants mimicking human disease variants

    • Gynogenetic screening: Rapidly identify chromosome location of mutations affecting mitochondrial function

    • Tissue chimeras: Determine tissue-autonomous versus non-autonomous effects of mitochondrial import defects

Recent studies have shown that mutations in human TIMM23 and its associated components lead to neurodevelopmental disorders. By introducing equivalent mutations in X. tropicalis TIMM23, researchers can study the developmental consequences of impaired mitochondrial protein import in a vertebrate model system with significant advantages over mammalian models for early developmental stages.

What is the role of the TIMM23 complex in regulating reactive oxygen species in mitochondria?

Recent research reveals a complex relationship between the TIMM23 complex and reactive oxygen species (ROS) regulation:

  • ROMO1 interaction: ROMO1 (Reactive Oxygen Species Modulator 1) directly interacts with both TIMM23 and TIMM17A/B, forming a channel-like structure that influences both protein import and ROS production

  • Structural implications:

    • The interaction between TIMM17A/B variants with TIMM23 and ROMO1 creates two populations of highly similar complexes

    • These structural arrangements suggest functional specialization related to ROS management

  • Regulatory mechanisms:

    • Prohibitins (PHB1/PHB2) interact with the TIM23 complex and affect its stability

    • Depletion of PHB2 decreases levels of core TIM23 subunits, including TIMM23, TIMM17A, and TIMM17B

    • This suggests a regulatory link between mitochondrial membrane organization and protein import efficiency

To study this relationship experimentally, researchers can:

  • Measure ROS levels in systems with modified TIMM23-ROMO1 interactions

  • Assess mitochondrial membrane potential in the context of altered TIM23 complex assembly

  • Evaluate the impact of oxidative stress on protein import efficiency through the TIM23 complex

How do post-translational modifications affect TIMM23 function in different physiological contexts?

Post-translational modifications (PTMs) of TIMM23 represent an emerging area of research with significant implications for understanding the regulation of mitochondrial protein import:

  • Key modification sites:

    • The matrix-exposed loops of TIMM23 (particularly loop 1 containing residues 127-139) are accessible to matrix-localized modifying enzymes

    • The N-terminal domain exposed to the intermembrane space contains potential modification sites that may affect presequence recognition

  • Functional consequences:

    • Phosphorylation of key residues may alter the interaction between TIMM23 and the import motor component TIMM44

    • Oxidative modifications could affect the channel properties and gating behavior

    • Ubiquitination may regulate TIMM23 turnover and complex assembly

  • Physiological contexts:

    • Development: PTM patterns may change during embryonic development to accommodate changing mitochondrial protein import needs

    • Stress response: Oxidative stress likely induces specific PTMs that modulate import efficiency

    • Tissue-specific regulation: Different tissues may exhibit distinct PTM profiles corresponding to their metabolic requirements

Experimental approaches to study PTMs include:

  • Mass spectrometry analysis of purified TIMM23 under different physiological conditions

  • Site-directed mutagenesis of potential modification sites followed by functional assays

  • Comparison of PTM patterns across species to identify evolutionarily conserved regulatory mechanisms

How does X. tropicalis TIMM23 function compare to the dual TIMM23 system in humans?

The comparison between X. tropicalis TIMM23 and the human dual TIMM23 system reveals important evolutionary adaptations:

FeatureX. tropicalis TIMM23Human TIMM23 SystemFunctional Significance
Complex variantsOne primary formTwo variants (with TIMM17A or TIMM17B)Specialized functions in different tissues
Channel propertiesSimilar basic structureSubtle differences in cavity liningMay affect substrate specificity
Regulatory mechanismsLess complexMore sophisticated regulationAdaptation to complex cellular environments
ROMO1 interactionPresentPresent in both variantsConserved role in ROS regulation
Expression patternMore uniformTissue-specific expressionSpecialized metabolic adaptations

The human TIMM23 complex exists in two main variants containing either TIMM17A or TIMM17B, forming complexes with distinct functional properties . The TIMM17B-containing complex is considered the housekeeping variant, while the TIMM17A complex may have specialized functions . This dual system likely evolved to accommodate the diverse metabolic needs of different mammalian tissues.

X. tropicalis, while having a simpler system, serves as an excellent model for the fundamental mechanisms of protein translocation, as the core structural and functional features are highly conserved .

What insights can cross-species structural analysis of TIMM23 provide for understanding channel gating mechanisms?

Cross-species structural analysis of TIMM23 has revealed critical insights into channel gating mechanisms:

  • Conserved functional elements:

    • The cavity responsible for translocating proteins is lined with highly conserved residues across species from yeast to humans and X. tropicalis

    • Negative charges at the intermembrane space-exposed part of TIMM23 are present across species, though their functional significance varies

  • Structural adaptations:

    • Loop regions connecting transmembrane domains show greater variability between species, suggesting species-specific regulatory mechanisms

    • The C-terminal unstructured region of TIMM17 (starting at residue 139 in yeast) shows high diversity across species

  • Gating mechanism insights:

    • Mutations in Tim23 loop 1 (particularly positions 137-139) in yeast compromise growth and association of PAM components with the translocon

    • The short helix in residues 137-141 appears critical for interaction with the import motor component Tim44

    • These structural features are conserved in X. tropicalis, suggesting a similar gating mechanism

By comparing TIMM23 structures across species and correlating structural features with functional data, researchers can identify conserved elements essential for channel gating as well as species-specific adaptations. Computational approaches using AlphaFold2 multimer models have proven particularly valuable for predicting and comparing these structures .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.