Recombinant Xenopus tropicalis N-acetylaspartate synthetase (nat8l)

Shipped with Ice Packs

In Stock

Cat. No.

BT2443285

Source

in vitro E.coli expression system

Synonyms

nat8l; N-acetylaspartate synthetase; NAA synthetase; N-acetyltransferase 8-like protein

Quick Inquiry

Product Specs

Form

Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time

Delivery times vary depending on the purchase method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.

Notes

Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.

Reconstitution

Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.

Shelf Life

Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.

Storage Condition

Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.

Tag Info

Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms

nat8l; N-acetylaspartate synthetase; NAA synthetase; N-acetyltransferase 8-like protein

Buffer Before Lyophilization

Tris/PBS-based buffer, 6% Trehalose.

Datasheet

Please contact us to get it.

Expression Region

1-271

Protein Length

full length protein

Species

Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)

Target Names

nat8l

Target Protein Sequence

MTYRGTRKSPCCSPPPRCGPPLPSGPAGSALGPPSSGAEEEMTKEQVYLREFQPADQEFA RRIFYEGIKERILSSAFRGLKYQPLLQSVYAVIIIMCFVVTKSLLVTCCMPLFLLGMRYY YSRKIILNHLECALRTDMSDIEQYYMKQPGSCFWVAVLEGKVVGIVAARGNEEDNVVELR RMSVDSNYRGKGIAKALGRKVLEFAMLNHYSSIVLGTTAVKIAAHKLYESLGFKHVGVVE HHIVPGMTHSLLERLFFQLRYHRYCLQLREE

Uniprot No.

A4II32

Target Background

Function

N-acetylaspartate synthetase (NAT8L) may regulate lipogenesis through N-acetylaspartate (NAA) production, a brain-specific metabolite. It may also enhance dopamine uptake by modulating TNF-α expression.

Database Links

KEGG: xtr:100124940

STRING: 8364.ENSXETP00000052747

UniGene: Str.64348

Protein Families

Camello family

Subcellular Location

Cytoplasm. Membrane; Single-pass membrane protein. Microsome membrane; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein. Rough endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

Basic Research Questions

What is N-acetylaspartate synthetase (NAT8L) and what is its primary function?

N-acetylaspartate synthetase (NAT8L) is an enzyme that catalyzes the synthesis of N-acetylaspartate (NAA) from L-aspartate and acetyl-CoA. NAA is the second most abundant metabolite in the vertebrate nervous system, with concentrations around 10 mM . The Xenopus tropicalis NAT8L (encoded by the nat8l gene) is highly conserved between all mammalian species .

NAT8L functions primarily in the acetylation pathway, where it:
- Converts aspartate and acetyl-CoA to NAA
- Contributes to brain development and myelin formation
- May play roles in osmoregulation and axon-glial signaling
Structurally, NAT8L belongs to the camello family of proteins , which have been identified as having histone acetyltransferase activity, particularly for histone H4 .
What expression systems are used for producing recombinant Xenopus tropicalis NAT8L?

Based on the available data, recombinant Xenopus tropicalis NAT8L has been successfully expressed in:
- E. coli expression systems
- Wheat germ cell-free expression systems
- Yeast expression systems
The E. coli expression system appears to be the most commonly used method for producing recombinant NAT8L protein for research purposes. The protein is typically tagged with an N-terminal histidine tag (His-tag) to facilitate purification .

What are the recommended storage conditions for recombinant Xenopus tropicalis NAT8L?

For optimal stability and activity of recombinant Xenopus tropicalis NAT8L, the following storage conditions are recommended:

Storage Form	Temperature	Duration	Buffer Conditions
Lyophilized	-20°C/-80°C	12 months	N/A
Liquid	-20°C/-80°C	6 months	Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Working aliquots	4°C	Up to 1 week	Various buffers

Additional recommendations include:

Avoiding repeated freeze-thaw cycles
Aliquoting the protein solution before freezing
Adding glycerol (5-50% final concentration) for long-term storage

Advanced Research Questions

Quick Inquiry

Personal Email Detected

Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Name*

Email*

Phone

Country

Source

Quantity&Size*

Product Name

Message

Recombinant Xenopus tropicalis N-acetylaspartate synthetase (nat8l)

Product Specs

Target Background

Q&A

Basic Research Questions

Advanced Research Questions

Quick Inquiry

Category

Service