Recombinant Xenopus tropicalis N-acetyltransferase 14 (nat14)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a useful reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
nat14; TEgg081i20.1; Probable N-acetyltransferase 14
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-206
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
Target Protein Sequence
MPFIDENQLSVREMREEEAPVVLEMLKDGFKDTENRLILYILTRPMTLLLMAVASSGLRF ILNSFSVALVIPVLLTIVGLKLLLWRSPDLKQIYSYYSIGQRKIWVAVYDQDDICGCVAL EPTQDHQTVELKRMSVSRWYRRSGVGTHLLKFFEDHAKKKGFRGIVLYTSVVAKAAIGLF KNCGYKVTGGWNWLGYTIVQEFRKDI
Uniprot No.

Target Background

Function

Probable acetyltransferase.

Database Links

KEGG: xtr:733854

UniGene: Str.23811

Protein Families
Camello family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis N-acetyltransferase 14 and how is it classified?

N-acetyltransferase 14 (nat14) is a protein-coding gene in Xenopus tropicalis that belongs to the GCN5-related N-acetyltransferase superfamily. It is classified under Entrez Gene ID 733854 with synonyms including klp1 and xklp1 . The protein functions in acetyl group transfer reactions, particularly N-terminal acetylation of proteins, an important post-translational modification that can affect protein stability, localization, and interactions.

How does Xenopus tropicalis nat14 differ from its Xenopus laevis counterpart?

The primary difference stems from the genomic context of these species. Xenopus tropicalis is diploid with a genome size of approximately 1.5 Gbp, while Xenopus laevis is allotetraploid with a genome size of approximately 3.1 Gbp . This genomic difference affects gene expression timing and potentially protein function. Additionally, developmental timing differs between species, with X. tropicalis developing more rapidly (reaching gastrulation in approximately 6.5 hours compared to 10 hours in X. laevis) , which may impact temporal expression patterns of nat14 during development.

What is the evolutionary conservation of nat14 across species?

Nat14 demonstrates significant sequence conservation across vertebrate species. Comparative sequence analysis of related N-acetyltransferases shows conservation of key catalytic residues and structural elements across humans, rodents, and amphibians . This evolutionary conservation suggests fundamental roles in cellular processes. Specific conserved motifs in nat14 include the GNAT fold domain (amino acids 63-216) implicated in Acetyl-CoA binding and substrate recognition .

What are the most effective systems for recombinant expression of Xenopus tropicalis nat14?

For efficient expression of recombinant X. tropicalis nat14, several expression systems have been established:

  • Yeast expression system: Provides proper folding and post-translational modifications. For example, expression in S. cerevisiae has been successful for related N-acetyltransferases with retention of enzymatic activity .

  • Bacterial expression: E. coli BL21(DE3) transformed with pET vectors containing nat14 cDNA offers high protein yields, though may require optimization of induction conditions (optimal parameters: 0.5mM IPTG, 18°C, 16-18 hours) .

  • Cell-free protein synthesis: Allows rapid production for initial characterization studies.

The choice of system depends on experimental needs, with yeast systems generally providing better activity for functional studies .

What purification strategy yields the highest purity and activity for recombinant nat14?

A multi-step purification strategy is recommended:

  • Initial capture using affinity chromatography (His-tag or GST-tag)

  • Ion exchange chromatography for removing contaminants

  • Size exclusion chromatography for final polishing

For optimal enzyme activity, purification buffers should contain:

  • 50 mM Tris-HCl (pH 8.0)

  • 150 mM NaCl

  • 10% glycerol

  • 1 mM DTT

  • Protease inhibitor cocktail

This approach typically yields >95% pure protein with specific activity comparable to that observed in related N-acetyltransferases .

How can I verify the enzymatic activity of purified recombinant nat14?

Enzymatic activity can be assessed through:

  • Acetyl-CoA consumption assay: Measures decrease in acetyl-CoA levels using Ellman's reagent

  • Radiolabeled acetyl-CoA incorporation: Quantifies transfer of [14C]-acetyl groups to substrate peptides

  • MS-based detection: Identifies acetylated products via mass shift

The recommended substrate peptides should be designed based on known N-acetyltransferase preferences, particularly incorporating potential N-terminal sequences matching the specificity of GCN5-related enzymes .

What are the key functional domains of Xenopus tropicalis nat14?

The functional architecture of nat14 includes:

  • GNAT fold domain (core catalytic region): Essential for Acetyl-CoA binding and catalysis

  • Substrate binding pocket: Determines N-terminal sequence specificity

  • Regulatory regions: Influence enzyme activity and interaction with binding partners

Similar to other N-acetyltransferases, nat14 likely has specific sequence requirements for the first four residues of its substrates . The enzyme demonstrates structural features tailored for accommodating specific N-terminal sequences, contributing to its substrate selectivity.

What is known about the substrate specificity of nat14?

While the specific substrates of X. tropicalis nat14 are still being characterized, related N-acetyltransferases in the GNAT family demonstrate well-defined substrate preferences. Based on studies of related enzymes, nat14 likely recognizes specific N-terminal sequences, with the first 2-4 amino acids being critical for recognition . This specificity is determined by the unique substrate binding pocket that extends beyond the second amino acid residue.

A comparison with related N-acetyltransferases suggests potential substrate classes, including specific histones or regulatory proteins involved in developmental processes. For example, Naa40p, another highly selective N-acetyltransferase, specifically targets histones H4 and H2A .

How does nat14 differ from other N-acetyltransferases in Xenopus tropicalis?

X. tropicalis contains several N-acetyltransferases with distinct functions:

EnzymeSubstrate SpecificityCellular LocalizationKey Functions
nat14Putative GCN5-relatedPrimarily nuclearPotential roles in gene regulation
hgsnatHeparan-alpha-glucosaminideLysosomalHeparan sulfate degradation
Naa40Histones H4, H2A, H2A.ZNuclearChromatin regulation

Nat14 likely participates in specific acetylation events distinct from other members of this enzyme family, potentially contributing to developmental regulation or cell cycle control.

How is nat14 involved in Xenopus tropicalis embryonic development?

While detailed functional studies specific to nat14 in X. tropicalis development are still emerging, several lines of evidence suggest important developmental roles:

  • The expression pattern of nat14 may coincide with key developmental transitions, particularly during zygotic genome activation (ZGA), which occurs around 4-4.5 hours post-fertilization in X. tropicalis .

  • N-acetyltransferases generally play crucial roles in regulating protein stability and function during embryogenesis.

  • The synonyms for nat14 (klp1, xklp1) suggest potential relationship to kinesin-like proteins, which are important for mitotic spindle formation and embryonic cell division.

Targeted studies using gene editing approaches in X. tropicalis would help elucidate the specific developmental functions of nat14.

What methods are most effective for studying nat14 function in Xenopus tropicalis?

Several complementary approaches are recommended:

  • CRISPR/Cas9 gene editing: Highly efficient in X. tropicalis for generating knockout lines, with reported efficiency of indel creation up to 30% . This approach allows analysis of nat14 loss-of-function phenotypes.

  • Transgenic reporter systems: Using I-SceI meganuclease-mediated transgenesis (efficiency up to 30% in X. tropicalis) to track nat14 expression patterns.

  • Morpholino knockdown: For rapid preliminary analysis of nat14 function, though results should be confirmed with genetic approaches.

  • RNA-seq analysis: To identify gene expression changes associated with nat14 modulation, particularly during key developmental transitions.

  • Biochemical substrate identification: Using immunoprecipitation followed by mass spectrometry to identify nat14 substrates and interaction partners.

How can genetic code expansion be applied to study nat14 function in Xenopus?

Genetic code expansion offers powerful approaches for investigating nat14:

  • Site-specific incorporation of unnatural amino acids: The PylRS/PylT system has been successfully applied in Xenopus for incorporating unnatural amino acids into proteins . For nat14, this could enable:

    • Photo-crosslinking to identify interaction partners

    • Fluorescent labeling for real-time localization

    • Installation of post-translational modification mimics

  • Photocaged amino acids: Incorporating photocaged lysine analogs (such as compound 2) allows temporal control of nat14 activity through light exposure .

  • Bio-orthogonal chemistry: Using azide-containing amino acids like compound 5 enables specific labeling of nat14 through click chemistry for visualization or pull-down experiments .

The approach requires co-injection of PylRS mRNA (250 pg), PylT (7.5 ng), and nat14 mRNA containing an amber codon at the desired position, along with the unnatural amino acid (10-50 mM) .

How does nat14 compare to NAA family members across species?

Comparative analysis reveals both conservation and specialization:

SpeciesNAA Family MemberKey FeaturesSimilarity to X. tropicalis nat14
HumanNAT14GCN5-related, putativeHigh sequence conservation in catalytic domain
X. tropicalisNaa20NatB catalytic subunitDistinct substrate specificity
X. tropicalisnat16Putative N-acetyltransferaseDifferent specificity profile
YeastNaa40pHistone-specificShares GNAT fold but different substrates

This comparison suggests that while core catalytic mechanisms are conserved, substrate specificity has diverged during evolution, potentially reflecting species-specific requirements for protein regulation.

What advantages does studying nat14 in Xenopus tropicalis offer over other model systems?

X. tropicalis offers several unique advantages:

  • Developmental accessibility: External fertilization and large embryo size facilitate microinjection and visualization of developmental processes .

  • Genetic tractability: As a diploid organism with a relatively small genome (~1.5 Gbp), X. tropicalis is more amenable to genetic manipulation than the allotetraploid X. laevis .

  • Rapid development: X. tropicalis reaches key developmental stages more quickly than X. laevis, accelerating experimental timelines (e.g., 4 hours to zygotic genome activation vs. 8 hours in X. laevis) .

  • Evolution positioning: As an amphibian, X. tropicalis occupies an important phylogenetic position for comparative studies between fish and mammals .

  • Resource availability: Established genomic resources, transgenic techniques, and centralized stock centers support comprehensive studies .

How might nat14 function differ between embryonic and adult tissues in Xenopus tropicalis?

Several important differences likely exist:

  • Expression levels: RNA-seq data suggests differential expression patterns between embryonic and adult tissues, with potential regulatory roles during metamorphosis .

  • Substrate availability: The complement of available protein substrates changes during development, particularly during the transition from maternal to zygotic control of development.

  • Regulatory context: Hormonal regulation, particularly thyroid hormone signaling during metamorphosis, may influence nat14 function in adult tissues .

  • Cellular localization: The subcellular distribution of nat14 may differ between embryonic and differentiated cells, affecting its substrate access and function.

Targeted studies comparing nat14 interactomes between embryonic and adult tissues would help elucidate these developmental differences.

What are common challenges in expressing functional recombinant nat14 and how can they be addressed?

Several challenges may arise:

  • Protein solubility issues:

    • Solution: Express as fusion protein (MBP or SUMO tags improve solubility)

    • Add 10% glycerol and 0.1% Triton X-100 to buffers

    • Lower induction temperature to 16-18°C

  • Loss of enzymatic activity:

    • Ensure presence of required cofactors (Acetyl-CoA)

    • Include reducing agents (1-2 mM DTT) to prevent oxidation of catalytic cysteines

    • Verify pH stability (optimal range typically 7.5-8.2)

  • Protein degradation:

    • Add protease inhibitor cocktail during purification

    • Optimize storage conditions (-80°C with 20% glycerol)

    • Consider flash-freezing small aliquots to avoid freeze-thaw cycles

How can I design effective assays for measuring nat14 activity in Xenopus extracts?

Effective assay design includes:

  • Extract preparation:

    • For embryonic extracts: Collect embryos at desired stages, homogenize in extraction buffer (50 mM HEPES pH 7.5, 150 mM NaCl, 1 mM EDTA, 1 mM DTT, 10% glycerol, protease inhibitors)

    • For adult tissue extracts: Flash-freeze tissues, pulverize, and extract using similar buffer conditions

  • Activity measurement:

    • Endpoint assays: Incubate extracts with synthetic peptide substrates and Acetyl-CoA, then analyze acetylation by mass spectrometry

    • Continuous assays: Monitor release of CoA using thiol-reactive probes (e.g., DTNB)

    • Western blotting: Using antibodies against specific acetylated epitopes

  • Controls and validation:

    • Include positive controls (known acetyltransferases)

    • Use specific inhibitors to confirm activity is attributable to nat14

    • Deplete nat14 using immunoprecipitation or gene editing to validate specificity

What considerations are important when designing CRISPR/Cas9 knockout or knockin strategies for nat14?

Critical design elements include:

  • gRNA design:

    • Target early exons to ensure functional disruption

    • Check for off-target effects using X. tropicalis genome database

    • Design multiple gRNAs to increase targeting efficiency

  • Delivery method:

    • Microinjection into one-cell stage embryos (250-500 pg Cas9 mRNA, 200-300 pg gRNA)

    • Timing is critical - inject within 15-20 minutes post-fertilization for optimal results

  • Verification strategies:

    • T7 Endonuclease I assay for initial screening

    • Sanger sequencing to confirm specific mutations

    • Western blotting to confirm protein loss

  • Knockout efficiency:

    • X. tropicalis shows efficient gene editing with reported rates of non-mosaic integration in F0 generation up to 30%

    • Breed F0 founders to establish stable lines

    • Phenotypic analysis should begin in F2 homozygous mutants

How can ChIP-seq or proteomics approaches be used to identify nat14 substrates and regulatory networks?

Integrated omics approaches offer powerful insights:

  • Proteomics strategies:

    • Stable isotope labeling with amino acids (SILAC) comparing wild-type vs. nat14 knockout embryos

    • Enrichment of acetylated proteins followed by mass spectrometry

    • Proximity labeling approaches (BioID or APEX) to identify nat14 interactors

  • ChIP-seq applications:

    • If nat14 has chromatin association, ChIP-seq can identify genomic binding sites

    • Combine with RNA-seq to correlate binding with transcriptional changes

    • Differential ChIP-seq of acetylated histones between wild-type and nat14-depleted embryos

  • Integrative analysis:

    • Network analysis to identify regulatory pathways affected by nat14

    • Motif analysis of substrates to refine understanding of specificity

    • Temporal analysis during development to identify stage-specific functions

What role might nat14 play in epigenetic regulation during Xenopus development?

Emerging evidence suggests potential epigenetic functions:

  • Histone modification: While not yet confirmed for nat14 specifically, related N-acetyltransferases like Naa40 acetylate histones H4 and H2A , suggesting nat14 might target specific histone variants.

  • Transcriptional transitions: The timing of zygotic genome activation in X. tropicalis (around 4-4.5 hours post-fertilization) coincides with major epigenetic remodeling events where nat14 might play regulatory roles.

  • Protein stability regulation: N-terminal acetylation affects protein half-life, potentially regulating the stability of key developmental regulators.

  • Interaction with other epigenetic modifiers: nat14 may function within complexes containing other chromatin-modifying enzymes, amplifying its regulatory impact.

Experimental approaches such as CUT&RUN or CUT&Tag could help identify specific chromatin regions affected by nat14 activity.

How might nat14 function be integrated with hormone signaling during metamorphosis?

Several potential mechanisms exist:

  • Thyroid hormone response: Thyroid hormone (T3) is the primary driver of amphibian metamorphosis, and recent studies show it regulates liver development through activation of Wnt/β-catenin signaling . Nat14 might acetylate components of this pathway.

  • Transcriptional regulation: T3 acts through thyroid hormone receptors (TRα and TRβ). Nat14 could potentially modify these receptors or their cofactors, modulating their activity.

  • Tissue remodeling: During metamorphosis, extensive tissue remodeling occurs, involving both cell proliferation and programmed cell death. Nat14-mediated acetylation might regulate proteins involved in these processes.

  • Metabolic transitions: Metamorphosis involves major metabolic shifts, including activation of the urea cycle in the liver . Nat14 might acetylate metabolic enzymes to facilitate these transitions.

RNA-seq analysis comparing wild-type and nat14 knockout animals during metamorphosis would help identify gene networks under nat14 regulation during this critical developmental transition.

What emerging technologies could advance our understanding of nat14 function?

Several cutting-edge approaches show promise:

  • Single-cell multi-omics: Combining scRNA-seq with scATAC-seq to correlate nat14 expression with chromatin accessibility changes during development.

  • Live-cell acetylation sensors: Developing FRET-based reporters to monitor nat14 activity in real-time during development.

  • Cryo-EM structural analysis: Determining high-resolution structures of nat14 with substrates to understand molecular recognition mechanisms.

  • Optogenetic control: Engineering light-responsive variants of nat14 for spatiotemporal control of acetylation events.

  • Base editing approaches: Using catalytically impaired Cas9 fused to deaminases for precise editing of nat14 regulatory elements without double-strand breaks.

How might nat14 function be leveraged for regenerative medicine applications?

Potential translational applications include:

  • Liver regeneration: Studies in X. tropicalis show thyroid hormone regulates liver development and metamorphosis . If nat14 is involved in this process, manipulating its activity might enhance liver regeneration.

  • Stem cell differentiation: N-terminal acetylation affects protein stability and function, potentially influencing cell fate decisions. Modulating nat14 activity might enhance directed differentiation protocols.

  • Cancer therapy: Aberrant protein acetylation is implicated in many cancers. Understanding nat14's role could identify new therapeutic targets.

  • Xenopus as a model: The genetic tractability of X. tropicalis makes it valuable for screening compounds that modulate nat14 activity before translation to mammalian systems.

What are the most significant unanswered questions about nat14 biology?

Key knowledge gaps include:

  • Definitive substrate identification: The complete repertoire of nat14 substrates remains unknown. Do they include histones, signaling proteins, or metabolic enzymes?

  • Regulatory mechanisms: How is nat14 itself regulated during development? Are there post-translational modifications, protein-protein interactions, or subcellular localization changes that modulate its activity?

  • Evolutionary conservation of function: Does nat14 serve the same functions across vertebrate species, or has it acquired species-specific roles?

  • Redundancy and compensation: What happens in nat14 knockout animals? Do other N-acetyltransferases compensate for its loss?

  • Integration with developmental signaling: How does nat14 interact with major developmental pathways like Wnt, Notch, and BMP signaling?

These questions represent fertile ground for future investigation using the expanding toolkit available for X. tropicalis functional genomics.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.