Recombinant Xenopus tropicalis NEDD4 family-interacting protein 1 (ndfip1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2493102
Source
in vitro E.coli expression system
Synonyms
ndfip1; NEDD4 family-interacting protein 1
Quick Inquiry

Description

Functional Roles in Ubiquitination and Cellular Regulation

Recombinant ndfip1 serves as a critical adaptor in ubiquitination cascades, exemplified by its interactions with key targets:

Regulation of Ion Channels

  • TRESK Channel Modulation:
    Ndfip1 recruits NEDD4 ligases to ubiquitinate the TWIK-related spinal cord K⁺ (TRESK) channel, reducing its cell-surface expression and current amplitude in Xenopus oocytes. Co-immunoprecipitation assays confirm direct binding, and ubiquitination assays demonstrate proteasome-dependent degradation .

ParameterTRESK Current ReductionUbiquitination Level
With Ndfip160–70% decrease High (MG132-sensitive)
With Dominant-Negative Nedd4No significant change Low

Metal Homeostasis

  • DMT1 Regulation:
    Ndfip1 promotes ubiquitination and degradation of divalent metal transporter 1 (DMT1), preventing iron overload in neurons. SH-SY5Y cells lacking ndfip1 show impaired DMT1 downregulation under cobalt exposure .

ConditionDMT1 Protein LevelUbiquitination
Ndfip1 KnockoutIncreased Reduced
Ndfip1 OverexpressionDecreased Enhanced

Neuroprotection

  • Parkinson’s Disease Models:
    In rotenone-induced SH-SY5Y cells (a Parkinson’s model), ndfip1 overexpression reduces α-synuclein accumulation by 40% and caspase-3 activation by 35%, rescuing tyrosine hydroxylase (TH) levels .

  • Iron Toxicity Mitigation:
    Ndfip1-deficient neurons exhibit elevated iron uptake and oxidative stress, reversed by recombinant ndfip1 supplementation .

Immune Modulation

  • Treg Cell Metabolism:
    Ndfip1 limits mTORC1 signaling and glycolysis in regulatory T cells, preventing aberrant proliferation and IL-4 secretion. Proteomic analyses reveal altered metabolic pathways in ndfip1-deficient Tregs .

Spatial Memory Formation

  • Ndfip1 knockout mice exhibit impaired spatial memory linked to dysregulated Beclin 1 ubiquitination. Recombinant ndfip1 restores hippocampal proteostasis, highlighting its role in synaptic plasticity .

Comparative Analysis Across Species

While Xenopus tropicalis ndfip1 shares >80% sequence homology with mammalian orthologs, functional studies highlight conserved roles:

SpeciesKey Functional OverlapUnique Features
Human (NDFIP1)DMT1 regulation, T-cell modulation Broader tissue expression
Mouse (Ndfip1)Neuronal survival, iron homeostasis Enhanced CNS-specific phenotypes
Xenopus tropicalisTRESK channel regulation Optimized for cell-free expression

Technical Considerations for Experimental Use

  • Storage: Lyophilized powder stable at -80°C; reconstitute in Tris/PBS buffer with 6% trehalose .

  • Activity Validation: Functional assays (e.g., ubiquitination, co-IP) are recommended due to variable host-system performance .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag will be determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ndfip1; NEDD4 family-interacting protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-211
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ndfip1
Target Protein Sequence
MSEQSSSRYQQLQNEEEPGENPQASTDAPPPYSSIAGESSGLFDYKDELGFPKPPSYNVA TSLPSYDEAERTKAEATIPLVPGRDDDFVARDDFDDADQLRIGNDGIFMLTFFMAFLFNW IGFFLSFCLTSSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFL LFLRGFINYAKVRKMPDNFSTLPRTRVLFIY
Uniprot No.
Q4V786

Target Background

Function

Plays a potential role in Golgi apparatus structural maintenance.

Database Links

KEGG: xtr:613097

STRING: 8364.ENSXETP00000042319

UniGene: Str.49506

Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.