Recombinant Xenopus tropicalis Nuclear envelope phosphatase-regulatory subunit 1 (cnep1r1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2434216
Source
in vitro E.coli expression system
Synonyms
cnep1r1; tmem188; TEgg132c10.1; Nuclear envelope phosphatase-regulatory subunit 1; Transmembrane protein 188
Quick Inquiry

Description

Introduction to Recombinant Xenopus tropicalis Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1)

Recombinant Xenopus tropicalis Nuclear Envelope Phosphatase-Regulatory Subunit 1 (CNEP1R1) is a protein derived from the African clawed frog, Xenopus tropicalis. This protein is part of a larger complex involved in the regulation of nuclear envelope phosphatase activity. The CNEP1R1 protein plays a crucial role in cellular processes by forming an active complex with serine/threonine protein phosphatase CTDNEP1, which is essential for dephosphorylating and potentially activating proteins like LPIN1 and LPIN2 .

Function and Mechanism

The primary function of CNEP1R1 is to act as a regulatory subunit for the nuclear envelope phosphatase complex. This complex is vital for maintaining the morphology of the endoplasmic reticulum (ER) membrane by regulating the phosphorylation status of key proteins . The interaction between CNEP1R1 and CTDNEP1 facilitates the dephosphorylation of target proteins, which can modulate their activity and cellular localization.

Research Applications

Recombinant Xenopus tropicalis CNEP1R1 is used in research settings, particularly for studying cellular signaling pathways and protein regulation. It is often employed in ELISA (Enzyme-Linked Immunosorbent Assay) kits to detect and quantify the protein in various samples . These kits are essential for understanding the expression levels and activity of CNEP1R1 in different biological contexts.

Data and Findings

While specific data on the recombinant Xenopus tropicalis CNEP1R1 might be limited, research on its human counterpart provides insights into its potential functions and mechanisms. The human CNEP1R1 gene is located on chromosome 16 and plays a role in forming the CTDNEP1-NEP1R1 complex, which is necessary for maintaining ER membrane morphology .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, please specify your required tag type for preferential development.
Synonyms
cnep1r1; tmem188; TEgg132c10.1; Nuclear envelope phosphatase-regulatory subunit 1; Transmembrane protein 188
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
cnep1r1
Target Protein Sequence
MNSLEQAEDLKAFERRLTEYVSCLQPATGRWRMILIVVSVCTATGAWNWLIDPETQKVSF FTSLWNHPFFTISCITLIGLFFAGIHKRVVAPSIIAARCRTVLAEYNMSCDDTGKLILKP RPHVQ
Uniprot No.
Q5M8F7

Target Background

Function
This protein may form an active complex with the serine/threonine protein phosphatase ctdnep1, resulting in the dephosphorylation and activation of lipins. Lipins are phosphatidate phosphatases that catalyze the conversion of phosphatidic acid to diacylglycerol, thereby regulating fatty acid metabolism at various levels. This protein may indirectly modulate the lipid composition of nuclear and/or endoplasmic reticulum membranes, and it may be essential for maintaining proper nuclear membrane morphology and/or dynamics. Additionally, it may indirectly regulate lipid droplet production and triacylglycerol levels.
Database Links

KEGG: xtr:496772

STRING: 8364.ENSXETP00000051831

UniGene: Str.1469

Protein Families
CNEP1R1 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Cytoplasm.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.