Recombinant Xenopus tropicalis Oligosaccharyltransferase complex subunit ostc (ostc)

Shipped with Ice Packs
In Stock

Description

Introduction

Oligosaccharyltransferase (OST) is a highly conserved membrane protein complex responsible for the N-linked glycosylation of proteins in eukaryotes . This process involves the transfer of a 14-sugar oligosaccharide from a dolichol lipid carrier to specific asparagine residues within the Asn-X-Ser/Thr sequon of nascent polypeptide chains . The OST complex is essential for protein folding, stability, and function within the endoplasmic reticulum (ER) .

OSTC: A Non-Catalytic Subunit of the OST Complex

OSTC (oligosaccharyltransferase complex non-catalytic subunit) is a specific component of the STT3A-containing form of the OST complex . It participates in the initial transfer of a glycan from a dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, which is the first step in protein N-glycosylation .

Structure and Function of OSTC

OSTC is a non-catalytic subunit of the OST complex, meaning it does not directly catalyze the glycosylation reaction . Instead, it plays a crucial role in the structure and function of the complex as a whole. The OST complex is composed of several different membrane-spanning proteins . These subunits are necessary for the OST complex to:

  • Position itself near the translocon pore .

  • Recognize and bind oligosaccharyldolichol .

  • Scan the nascent protein to recognize and bind sequons .

  • Move these two large substrates into their proper locations and conformations .

  • Activate the Asn amide nitrogen atom for the actual transfer of oligosaccharide .

  • Release its substrates .

OSTC in Xenopus tropicalis

Xenopus tropicalis is a widely used model organism in biological research, particularly in studies of developmental biology and genetics . Recombinant OSTC from Xenopus tropicalis refers to the OSTC protein that has been produced using recombinant DNA technology in Xenopus tropicalis . This allows researchers to study the structure, function, and interactions of OSTC in a controlled environment.

Significance of OSTC Research

Research on OSTC and the OST complex is crucial for understanding the fundamental mechanisms of protein glycosylation and its role in various cellular processes. Defects in the glycosylation pathway can lead to congenital disorders of glycosylation (CDG syndromes) . Additionally, OSTC may be involved in N-glycosylation of APP (amyloid-beta precursor protein) and can modulate gamma-secretase cleavage of APP by enhancing endoprotelysis of PSEN1 . By studying OSTC, scientists can gain insights into the pathogenesis of these diseases and develop potential therapeutic strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. To request a specific tag type, please inform us, and we will prioritize its development.
Synonyms
ostc; dc2; TNeu100m23.1; Oligosaccharyltransferase complex subunit ostc
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-149
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ostc
Target Protein Sequence
MESLYRVPFTVLECPNLKLKKPSWLHMPSAMTVYAMVVVSYFLITGGIIYDVIVEPPSVG SMTDEHGHQRPVAFLAYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLL LFIGFVCVLLSFFMARVFMRMKLPGYLMG
Uniprot No.

Target Background

Function
This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in N-linked glycosylation. N-glycosylation occurs co-translationally, and the complex associates with the Sec61 complex at the translocon, mediating protein translocation across the endoplasmic reticulum (ER). All subunits are essential for optimal enzyme activity.
Database Links

KEGG: xtr:549410

STRING: 8364.ENSXETP00000045608

UniGene: Str.227

Protein Families
OSTC family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis and why is it advantageous for studying OSTC?

Xenopus tropicalis is a small, fast-breeding, diploid frog species that has emerged as an important model organism for developmental genetics and functional genomics research. Compared to its relative Xenopus laevis, X. tropicalis offers several significant advantages for studying proteins like OSTC:

  • Diploid genome (unlike the allotetraploid X. laevis), simplifying genetic analysis

  • Shorter generation time (develops to sexual maturity in 1/3 the time of X. laevis)

  • Smaller genome size (approximately half that of X. laevis)

  • Requires 1/5 the housing space of X. laevis, reducing maintenance costs

  • Shares the same embryological advantages as X. laevis including external development, large embryo size, and amenability to microsurgical manipulation

  • Gene sequences are sufficiently similar between the two species that probes cross-react, allowing transfer of knowledge and techniques

For OSTC research specifically, these characteristics make X. tropicalis ideal for genetic approaches including forward genetic screens, generation of stable transgenic lines, and CRISPR/Cas gene editing to study glycosylation pathways in a vertebrate model.

What is the function of the oligosaccharyltransferase complex in which OSTC participates?

The oligosaccharyltransferase (OST) complex catalyzes the transfer of a defined glycan (Glc₃Man₉GlcNAc₂ in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains . This represents the critical first step in protein N-glycosylation, which occurs cotranslationally as the OST complex associates with the Sec61 complex at the channel-forming translocon in the endoplasmic reticulum (ER) .

In mammals, including X. tropicalis, there are two distinct OST complexes:

  • OST-A: Functions cotranslationally during protein synthesis

  • OST-B: Functions posttranslationally on proteins that have already been synthesized

How can basic techniques for X. tropicalis be applied to OSTC research?

Several well-established techniques can be applied to study OSTC in X. tropicalis:

  • mRNA microinjection: Synthetic OSTC mRNA can be injected into fertilized eggs or early embryos to study gain-of-function effects .

  • Morpholino antisense oligonucleotides: These can be injected to knock down OSTC expression, allowing assessment of loss-of-function phenotypes during development .

  • Whole-mount in situ hybridization: This technique can be used to determine the spatial and temporal expression patterns of OSTC mRNA during development. X. laevis probes often work well in X. tropicalis due to sequence similarity .

  • Immunohistochemistry: Antibodies developed against X. laevis OSTC can frequently be used with X. tropicalis, following established immunostaining procedures .

  • Transgenesis: The meganuclease method enables efficient generation of transgenic X. tropicalis lines expressing tagged versions of OSTC or reporter constructs under OSTC regulatory elements .

  • Tissue chimeras: Combining tissues from different embryos can help determine whether OSTC functions cell-autonomously or non-cell-autonomously .

What are the optimal approaches for generating recombinant X. tropicalis OSTC?

Multiple expression systems can be used to produce recombinant X. tropicalis OSTC, each with methodological considerations:

  • Bacterial expression systems: While cost-effective, these systems lack eukaryotic post-translational modifications crucial for OSTC function. Consider:

    • Using bacterial strains optimized for rare codon usage

    • Expressing OSTC as a fusion protein to improve solubility

    • Employing bacterial glycoengineering host strains if glycosylation is required

  • Cell-free expression systems: The Three-in-One Pot (TiOP) cell-free glycosylation assay can be adapted to express X. tropicalis OSTC:

    • Allows rapid screening of OSTC function with different glycans

    • Doesn't require recombinant expression of glycans

    • Provides a platform for testing OSTC activity before moving to more complex systems

  • Mammalian expression systems: Ideal for producing functional OSTC with appropriate post-translational modifications:

    • HEK293 cells are preferred for maintaining native folding and modification

    • Codon optimization for mammalian expression may improve yields

    • Consider using inducible expression systems to control timing and level of OSTC production

  • X. laevis oocyte expression: Injection of OSTC mRNA into X. laevis oocytes provides a vertebrate expression system closely related to the native environment:

    • Allows expression of proteins that might be toxic in other systems

    • Enables assessment of OSTC incorporation into endogenous OST complexes

    • Facilitates electrophysiological studies if OSTC affects membrane proteins

How can CRISPR/Cas9 gene editing be applied to study OSTC function in X. tropicalis?

CRISPR/Cas9 gene editing has been successfully demonstrated in X. tropicalis and provides powerful approaches for OSTC functional studies :

  • OSTC knockout generation:

    • Design guide RNAs targeting early exons of OSTC

    • Co-inject Cas9 protein and guide RNAs into fertilized X. tropicalis eggs

    • Screen F0 animals for mutations using T7 endonuclease assays or direct sequencing

    • Raise F0 mosaic animals to adulthood and breed to establish stable knockout lines

  • Knock-in approaches:

    • Design homology-directed repair templates containing tags (e.g., fluorescent proteins, epitope tags) or specific mutations

    • Co-inject with Cas9 and guide RNAs targeting the insertion site

    • Use fluorescence screening for tagged insertions or PCR-based genotyping for non-tagged modifications

  • Tissue-specific OSTC disruption:

    • Generate transgenic lines expressing Cas9 under tissue-specific promoters

    • Introduce guide RNAs targeting OSTC through breeding or injection

    • This approach allows examination of OSTC function in specific tissues without affecting early development

  • OSTC domain analysis:

    • Create targeted modifications to specific functional domains

    • Compare phenotypes with complete knockout to identify domain-specific functions

    • Use to dissect the role of OSTC in OST complex assembly versus function

What methods can assess OSTC glycosylation efficiency in X. tropicalis models?

Evaluating OSTC's role in glycosylation efficiency requires specialized techniques:

  • Cell-free glycosylation assays:

    • The TiOP assay can be adapted to test the activity of OST complexes containing wild-type or mutant OSTC

    • This approach enables rapid screening of glycosylation efficiency with various glycan and acceptor protein combinations

    • Comparative analysis of band intensity by western blot can provide semi-quantitative assessment of glycosylation efficiency

  • In vivo glycoprotein analysis:

    • Extract glycoproteins from wild-type and OSTC-modified X. tropicalis embryos or tissues

    • Analyze glycosylation patterns using mass spectrometry

    • Compare N-glycan profiles to identify specific changes in glycosylation efficiency or patterns

  • Glycoprotein reporter systems:

    • Generate transgenic lines expressing reporter proteins with multiple N-glycosylation sites

    • Introduce wild-type or modified OSTC into these backgrounds

    • Monitor changes in reporter glycosylation using mobility shift assays or glycan-specific staining

  • Structural analysis of OST complexes:

    • Cryo-electron microscopy can be used to examine how OSTC contributes to the structure of the OST complex

    • Compare structures containing wild-type versus mutant OSTC to identify conformational changes that affect glycosylation efficiency

How can X. tropicalis transgenic lines facilitate advanced OSTC studies?

Transgenic X. tropicalis lines offer powerful tools for OSTC research:

  • Reporter lines for developmental studies:

    • Generate lines expressing fluorescent reporters under the control of OSTC regulatory elements

    • Use to monitor spatiotemporal expression patterns during development

    • These lines can identify developmental stages and tissues for targeted functional studies

  • Binary expression systems:

    • The GAL4/UAS system can be implemented in X. tropicalis for controlled OSTC expression

    • Generate driver lines expressing GAL4 under tissue-specific promoters

    • Create responder lines with wild-type or mutant OSTC under UAS control

    • Cross these lines to achieve spatially and temporally controlled OSTC expression

  • Inducible systems:

    • Develop heat-shock or chemical-inducible OSTC expression systems

    • These enable precise temporal control over OSTC expression or knockout

    • Particularly valuable for studying OSTC functions at specific developmental stages

  • Fluorescently tagged OSTC:

    • Create lines expressing fluorescently tagged OSTC under endogenous regulatory elements

    • Use for live imaging of OSTC localization during development

    • Can be combined with other tagged OST components to study complex assembly dynamics

How do mutations in OSTC affect N-glycosylation in X. tropicalis versus other models?

Comparative analysis across model systems reveals important insights:

Model OrganismOSTC Mutation PhenotypesGlycosylation EffectsResearch Applications
X. tropicalisDevelopmental defects, potential lens abnormalitiesAltered N-glycan profiles, tissue-specific effectsVertebrate development studies, genetic screens
X. laevisSimilar to X. tropicalis but complicated by gene duplicationPossibly redundant function due to multiple gene copiesBiochemical studies, protein-protein interactions
Mammalian cellsER stress, altered glycoprotein quality controlSubstrate-specific glycosylation defectsDisease modeling, therapeutic development
C. elegansDevelopmental timing defectsSimplified glycan structures affectedGenetic interaction studies
DrosophilaMorphogenetic defectsGlycan subset affectedSignaling pathway analysis

Research has shown that OSTC mutations can have substrate-specific effects on glycosylation. For example, in mammalian systems, OSTC appears to influence the glycosylation of APP (amyloid-beta precursor protein) and can modulate gamma-secretase cleavage by enhancing endoproteolysis of PSEN1 . Similar substrate specificities may exist in X. tropicalis but require further investigation.

The comparative analysis of OSTC function across species can illuminate evolutionary conservation and divergence of N-glycosylation regulation, with X. tropicalis serving as an excellent intermediate model between invertebrates and mammals.

What technical considerations are important when working with recombinant X. tropicalis OSTC?

Several methodological considerations are crucial for successful work with recombinant X. tropicalis OSTC:

  • Protein stability and solubility:

    • OSTC is a membrane protein component of the OST complex

    • Expression strategies should account for hydrophobicity and membrane association

    • Consider using detergent optimization screens to identify conditions that maintain OSTC in solution

    • Fusion tags may improve solubility but should be carefully selected to avoid interfering with function

  • Complex assembly considerations:

    • OSTC functions as part of the multi-subunit OST complex

    • Co-expression with other OST components may be necessary for proper folding and activity

    • When evaluating OSTC function, consider its interactions with STT3A in the OST-A complex

  • Species-specific variation:

    • While X. tropicalis and X. laevis OSTC share high sequence similarity, subtle differences may affect function

    • When using antibodies or interaction assays, validate specificity for X. tropicalis OSTC

    • Consider potential differences in glycosylation machinery between X. tropicalis and expression host systems

  • Experimental timing:

    • X. tropicalis embryos develop more rapidly than X. laevis but follow the same developmental staging system

    • Careful timing is crucial when performing manipulations or collecting samples for OSTC analysis

    • Temperature control is particularly important as X. tropicalis tolerates a narrower temperature range than X. laevis

What are current research frontiers in X. tropicalis OSTC studies?

Current cutting-edge research areas include:

  • Substrate specificity:

    • Investigating which specific glycoproteins in X. tropicalis development depend on OSTC-containing OST complexes

    • Determining whether OSTC influences glycosylation site selection or efficiency in a substrate-specific manner

    • Exploring the intersection between OSTC function and developmentally regulated glycoproteins

  • Developmental regulation:

    • Examining how OSTC expression and function are regulated during X. tropicalis development

    • Investigating whether OSTC-dependent glycosylation has stage-specific or tissue-specific roles

    • Studying potential developmental compensation mechanisms when OSTC function is compromised

  • Structural biology approaches:

    • Applying cryo-electron microscopy to determine the structure of X. tropicalis OST complexes

    • Comparing structures with mammalian counterparts to identify conserved and divergent features

    • Using structural insights to predict and test functional domains within OSTC

  • Disease modeling:

    • Establishing X. tropicalis models for human disorders linked to OSTC dysfunction

    • Using these models to screen for compounds that might restore normal glycosylation

    • Investigating whether OSTC variants contribute to developmental disorders or congenital defects

  • Integration with other PTM systems:

    • Exploring the interplay between N-glycosylation and other post-translational modifications in X. tropicalis

    • Investigating whether OSTC influences or is influenced by other protein modification pathways

    • Examining potential cross-talk between different glycosylation pathways

These research frontiers highlight the versatility of X. tropicalis as a model organism for studying fundamental aspects of glycobiology and their relevance to human health and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.