Recombinant Xenopus tropicalis Organic solute transporter subunit alpha (osta)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus tropicalis Organic Solute Transporter Subunit Alpha (OSTα)

The recombinant Xenopus tropicalis organic solute transporter subunit alpha (OSTα) is a heterodimeric protein component critical for sterol and bile acid transport in epithelial cells. Expressed in E. coli and purified as a His-tagged fusion protein, this recombinant form retains structural and functional fidelity to its native counterpart. OSTα operates as part of the OSTα-OSTβ complex, which facilitates facilitated diffusion of bile acids, steroid metabolites, and certain drugs across basolateral membranes .

Functional Domains

OSTα contains seven transmembrane domains and forms a heterodimer with OSTβ, a single-transmembrane domain protein. The complex requires both subunits for proper plasma membrane localization and transport activity .

Transport Mechanism

OSTα-OSTβ mediates facilitated diffusion of substrates, including:

  • Bile acids: Taurocholate, cholic acid

  • Steroid metabolites: Estrone 3-sulfate, dehydroepiandrosterone 3-sulfate

  • Drugs: Digoxin, prostaglandin E2

This bidirectional transport depends on substrate concentration gradients, enabling efflux in the small intestine during enterohepatic circulation .

Regulatory Pathways

OSTα-OSTβ expression is upregulated by:

  • FXR (farnesoid X receptor): A bile acid sensor that activates slc51a (OSTα) and slc51b (OSTβ) transcription during cholestasis

  • Cholestasis: Hepatic OSTα-OSTβ levels rise in rodents and humans to mitigate bile acid toxicity

Model Organism Relevance

Xenopus tropicalis is a premier model for studying OSTα-OSTβ due to:

AdvantageDetail
Diploid GenomeSimplifies genetic mapping compared to allotetraploid X. laevis
Shorter Reproductive CycleFaster generation times (~3–4 months) for genetic studies
High Synteny to HumansConserved gene organization with mammals

Key Experimental Insights

  1. Co-Expression Dependency

    • OSTα and OSTβ must be co-expressed for proper membrane localization and function. In Xenopus laevis oocytes, OSTα alone fails to localize to the plasma membrane .

  2. Cholestasis Response

    • Hepatic OSTα-OSTβ upregulation in cholestasis protects against bile acid-induced liver injury. This mechanism is conserved across species, including Xenopus .

  3. Intestinal Protection

    • OSTα-OSTβ-mediated bile acid efflux in ileal enterocytes prevents intracellular accumulation and injury .

Handling and Stability

ConditionRecommendation
Storage-20°C/-80°C in lyophilized form; avoid repeated freeze-thaw cycles
Working AliquotsStore at 4°C for ≤1 week; use glycerol (5–50%) for long-term storage
ReconstitutionUse deionized sterile water; avoid prolonged exposure to pH extremes

Limitations

  • Species-Specific Variations: OSTα-OSTβ expression patterns differ between Xenopus and mammals (e.g., higher hepatic expression in humans) .

  • Functional Assays: Requires co-expression of OSTβ for transport activity, complicating in vitro studies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have a specific format preference, please indicate it in your order notes. We will then fulfill your request, if possible.
Lead Time
Delivery time may vary depending on your purchasing method and location. Kindly contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs unless otherwise requested. If you require dry ice shipment, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We advise centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
slc51a; osta; Organic solute transporter subunit alpha; OST-alpha; Solute carrier family 51 subunit alpha
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-339
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
slc51a
Target Protein Sequence
MDPEQNDTKPPFNPICATRQAPYSHEILENLDITGILLFAILTFMTLVSLLVFLEEAYYM YRKIPNPKNSIIIWINAGAMMIATTSCFGMWIPRSTMFTDFTASVFLAVLIHKFQLMLVN ECGGRREFLSTFGDTKLKISTGPFCCCCLCLPHKDINRKTLFILKLGTFQFAFLRPVLMF LAVVLWTNGTYMIGNSSAEKATIWINIGVGITTITALWAVGIMFNLVKDNLKEKNIIGKF AVYQFTVILSQLQTSIINILGTTGVISCVPPLPGPSRASYMNQQLLIMEMFLVTVICRVL YRRRYDDKNLLENQETNDNLRNSMMHLNGKALEDGPQSV
Uniprot No.

Target Background

Function
Essential component of the Ost-alpha/Ost-beta complex, a heterodimer that functions as the intestinal basolateral transporter responsible for exporting bile acids from enterocytes into portal blood.
Database Links
Protein Families
OST-alpha family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis Organic solute transporter subunit alpha (osta) and what is its function?

The Organic solute transporter subunit alpha (osta) from Xenopus tropicalis is a component of the heteromeric solute carrier protein OSTα/β that transports bile acids, steroid metabolites, and drugs into and out of cells. The full-length protein consists of 339 amino acids and is encoded by the slc51a gene . When partnered with OSTβ, it forms a functional transporter that is primarily involved in the recirculation of bile acids from the gut to the liver, with the highest expression found in the gastrointestinal tract . The protein plays a critical role in maintaining bile acid homeostasis and has been implicated in conditions characterized by elevated bile acid concentrations, including cholestasis and nonalcoholic steatohepatitis (NASH) .

How does the expression and function of recombinant Xenopus tropicalis osta compare to osta from other species?

Xenopus tropicalis osta shares structural and functional similarities with osta proteins from other species, though with distinct phylogenetic differences. For example, the Clonorchis sinensis OST demonstrates 23.1% similarity to the OST α-subunit of Xenopus tropicalis (XtOSTα; UniProt ID: A9ULC7) . In contrast to many mammalian systems where OSTα and OSTβ stabilize each other when co-expressed, studies in Xenopus laevis oocytes have shown that both OSTα and OSTβ subunits can independently reach the plasma membrane when singly expressed, though each subunit alone lacks transporter activity . This suggests species-specific variations in protein trafficking, though the requirement for both subunits for functional transport remains consistent across species.

What experimental approaches are recommended for studying OSTα/β transport function in Xenopus tropicalis?

Researchers investigating OSTα/β transport function should consider multiple experimental approaches:

  • Expression Systems: While E. coli is commonly used for recombinant protein production , functional studies of membrane transporters often employ Xenopus laevis oocytes or mammalian cell lines such as HEK293 or MDCK cells .

  • Transport Assays: To evaluate OSTα/β function, measure uptake or efflux of known substrates such as taurocholate or estrone sulfate. Compare transport in cells expressing both OSTα and OSTβ against cells expressing individual subunits or control cells .

  • Membrane Localization: Confirm proper membrane localization using confocal microscopy with fluorescently tagged proteins or surface biotinylation assays.

  • Protein-Protein Interaction: To study the interaction between OSTα and OSTβ subunits, employ co-immunoprecipitation, FRET (Fluorescence Resonance Energy Transfer), or BiFC (Bimolecular Fluorescence Complementation).

  • Mutagenesis: Conduct site-directed mutagenesis to identify critical residues for subunit interaction, membrane trafficking, and transport function.

How can researchers distinguish between functional effects of OSTα alone versus the OSTα/β heteromeric complex?

To distinguish the functional effects of OSTα alone versus the OSTα/β heteromeric complex:

  • Expression Controls: Establish experimental systems with carefully controlled expression of either OSTα alone, OSTβ alone, or both subunits together .

  • Subcellular Localization Analysis: Examine the subcellular localization of OSTα when expressed alone or with OSTβ using immunofluorescence microscopy. In most mammalian cells, OSTα requires OSTβ for proper membrane localization, though interestingly, in Xenopus laevis oocytes, both subunits can reach the plasma membrane independently despite lacking transport activity when expressed alone .

  • Protein Stability Assays: Compare the half-life of OSTα protein when expressed alone versus with OSTβ using cycloheximide chase experiments. Previous research indicates that co-expression significantly extends the half-life of OSTα beyond 24 hours, compared to approximately 2 hours when expressed alone .

  • Substrate Transport Studies: Quantify the transport of known substrates (bile acids, steroid metabolites) in systems expressing either individual subunits or both. Functional transport is only observed when both subunits are co-expressed .

What is the relationship between OSTα expression and bile acid homeostasis in amphibian models?

The relationship between OSTα expression and bile acid homeostasis in amphibian models involves several key aspects:

  • Tissue-Specific Expression: While OSTα/β is expressed in various tissues in amphibians, its expression is highest in tissues involved in bile acid transport, particularly the intestine, similar to mammalian systems .

  • Developmental Regulation: In Xenopus species, expression patterns of transporters may vary during development. Researchers should consider the developmental stage (such as Nieuwkoop and Faber stages) when designing experiments involving transporter expression and function .

  • Species Differences: Xenopus tropicalis and Xenopus laevis may exhibit differences in OSTα/β expression and function. These differences can be leveraged to understand evolutionary aspects of bile acid transport mechanisms .

  • Experimental Design Considerations: When studying bile acid homeostasis in amphibian models, researchers should control for environmental factors that may influence metabolism and transport, including temperature, feeding status, and housing conditions, as these can affect transporter expression and function .

What are the optimal protocols for expression and purification of recombinant Xenopus tropicalis osta?

Expression and Purification Protocol:

  • Expression System Selection:

    • E. coli is commonly used for recombinant Xenopus tropicalis osta protein expression

    • For functional studies, consider mammalian expression systems (HEK293, MDCK) or Xenopus laevis oocytes

  • Expression Construct Design:

    • Include appropriate tag (His-tag commonly used) for purification

    • Consider codon optimization for the expression system

    • Include the full-length sequence (339 amino acids) for complete functional analysis

  • Purification Protocol:

    • Lyse cells in appropriate buffer systems

    • Purify using affinity chromatography (Ni-NTA for His-tagged proteins)

    • Consider using detergents appropriate for membrane proteins

    • Further purification may include size exclusion chromatography

  • Storage Recommendations:

    • Store purified protein at -20°C/-80°C in Tris/PBS-based buffer with 6% Trehalose, pH 8.0

    • Avoid repeated freeze-thaw cycles

    • For working aliquots, store at 4°C for up to one week

    • Add glycerol (recommended final concentration 50%) for long-term storage

  • Reconstitution:

    • Briefly centrifuge vial before opening

    • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

What experimental design considerations are important when studying the interaction between OSTα and OSTβ subunits?

When designing experiments to study OSTα and OSTβ subunit interactions, researchers should consider:

  • Expression System Selection:

    • HEK293 or MDCK cells are appropriate for co-expression studies

    • Xenopus laevis oocytes provide a unique system where both subunits can reach the membrane independently

  • Stoichiometry Analysis:

    • Design experiments to determine the optimal expression ratio of OSTα to OSTβ

    • Consider variable intracellular expression of subunits when interpreting results

  • Protein-Protein Interaction Studies:

    • Use co-immunoprecipitation to confirm physical interaction

    • Consider crosslinking approaches for transient interactions

    • Proximity ligation assays can visualize interactions in situ

  • Membrane Trafficking Analysis:

    • Use cell surface biotinylation to quantify membrane-localized protein

    • Immunofluorescence microscopy with appropriate markers can determine subcellular localization

    • Time-course experiments can reveal trafficking kinetics

  • Transport Function Correlation:

    • Design transport assays using known substrates (taurocholate, estrone sulfate)

    • Compare transport activity with varying expression levels of each subunit

    • Correlate membrane expression with transport function

What controls and validation steps are essential when working with recombinant Xenopus tropicalis osta protein?

Essential controls and validation steps include:

  • Protein Quality Controls:

    • Confirm protein purity (>90% by SDS-PAGE)

    • Verify protein identity by Western blotting and/or mass spectrometry

    • Assess secondary structure using circular dichroism

  • Functional Validation:

    • Confirm membrane localization in expression systems

    • Verify transport activity using known substrates

    • Compare activity when expressed alone versus with OSTβ

  • Experimental Controls:

    • Include vector-only/mock transfection controls

    • Use known non-transported compounds as negative controls

    • Include positive controls (known transported substrates)

  • System-Specific Considerations:

    • For Xenopus-based studies, control for developmental stage using the Nieuwkoop and Faber staging system

    • Monitor environmental conditions (temperature, pH) that may affect protein function

  • Reproducibility Measures:

    • Standardize protein concentration determination methods

    • Maintain consistent experimental conditions across replicates

    • Include biological replicates from independent protein preparations

What are the emerging research opportunities in understanding the evolutionary conservation of OSTα across species?

The evolutionary conservation of OSTα offers several promising research directions:

  • Comparative Genomics Approach:

    • Expand analysis beyond the 23.1% similarity observed between Clonorchis sinensis OST and Xenopus tropicalis OSTα

    • Compare structure-function relationships across evolutionary distant species

    • Identify conserved motifs essential for function versus species-specific adaptations

  • Structural Biology Investigations:

    • Determine the three-dimensional structure of Xenopus tropicalis OSTα

    • Compare structural features with mammalian counterparts

    • Investigate how structural differences relate to functional variations

  • Transport Mechanism Studies:

    • Examine if the transport mechanism is conserved across species

    • Investigate substrate specificity differences between amphibian and mammalian OSTs

    • Explore how environmental adaptations influence transporter function

  • Developmental Biology Applications:

    • Analyze expression patterns during different developmental stages

    • Investigate the evolutionary significance of the independent membrane localization capability observed in Xenopus oocytes

What potential applications exist for using Xenopus tropicalis osta in bile acid transport and drug interaction studies?

Xenopus tropicalis osta offers several applications in research:

  • Bile Acid Transport Models:

    • Develop amphibian models to study enterohepatic circulation

    • Compare with mammalian systems to identify conserved transport mechanisms

    • Investigate how environmental factors affect bile acid transport in poikilothermic species

  • Drug Development Applications:

    • Screen for compounds that interact with osta as potential modulators of bile acid transport

    • Identify species-specific differences in drug-transporter interactions

    • Develop Xenopus-based assays for early drug-transporter interaction screening

  • Comparative Physiology Studies:

    • Investigate how amphibian bile acid transport adapts to environmental changes

    • Compare transport kinetics between mammalian and amphibian systems

    • Examine temperature-dependent effects on transport function

  • Translational Research Opportunities:

    • Apply findings from Xenopus studies to understand human bile acid transport disorders

    • Explore evolutionary adaptations that might inform therapeutic approaches

    • Develop comparative models for cholestasis and other bile acid-related disorders

What analytical techniques are most effective for studying the membrane localization and trafficking of Xenopus tropicalis osta?

Several analytical techniques are particularly effective:

TechniqueApplicationAdvantagesLimitations
Confocal MicroscopyVisualize subcellular localizationHigh resolution, 3D imaging capabilityRequires fluorescent tagging that may affect function
Total Internal Reflection Fluorescence (TIRF) MicroscopyMembrane-specific visualizationExcellent for plasma membrane eventsLimited to membrane-proximal regions
Surface BiotinylationQuantify surface expressionSpecific for plasma membrane proteinsIndirect measurement
Flow CytometryQuantify surface expression in large cell populationsHigh throughput, statistical powerLess detailed spatial information
Electron MicroscopyUltrastructural localizationHighest resolutionComplex sample preparation, potential artifacts
Live Cell ImagingTrack trafficking dynamicsReal-time informationPhototoxicity concerns with extended imaging

For optimal results, researchers should combine multiple techniques to comprehensively characterize membrane localization and trafficking of Xenopus tropicalis osta, particularly when studying its interaction with the β subunit and its functional consequences .

How can researchers effectively design experiments to study the impact of mutations on Xenopus tropicalis osta function?

When designing mutation studies for Xenopus tropicalis osta:

  • Mutation Selection Strategy:

    • Target conserved residues identified through sequence alignment across species

    • Focus on regions predicted to be involved in subunit interaction, membrane localization, or substrate binding

    • Consider the complete amino acid sequence provided in the database (339 amino acids)

  • Expression System Considerations:

    • Select appropriate expression systems based on experimental goals

    • Use E. coli for protein production and purification

    • Employ mammalian cells or Xenopus oocytes for functional studies

  • Functional Assessment Approach:

    • Compare wild-type and mutant proteins for:

      • Protein stability and expression level

      • Membrane localization

      • Interaction with OSTβ subunit

      • Transport activity with model substrates (taurocholate, estrone sulfate)

  • Data Analysis Framework:

    • Establish quantitative metrics for each parameter assessed

    • Use statistical approaches appropriate for the experimental design

    • Consider developing structure-function relationship models

By systematically applying these approaches, researchers can gain valuable insights into the critical residues and domains that govern Xenopus tropicalis osta function and its evolutionary relationship to other OST proteins.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.