Recombinant Xenopus tropicalis Peroxisomal membrane protein PEX16 (pex16)

Shipped with Ice Packs
In Stock

Description

Molecular Identity

Recombinant Xenopus tropicalis Peroxisomal membrane protein PEX16 (pex16) is classified as a transmembrane protein belonging to the peroxin family, a group of proteins essential for peroxisome biogenesis and maintenance . The protein is formally identified in databases with UniProt accession number B0JYZ2 and is also known by alternative names including Peroxin-16 and Peroxisomal biogenesis factor 16 . As a member of the PEX protein family, PEX16 plays specialized roles in the formation, maintenance, and proliferation of peroxisomes, which are membrane-bound organelles involved in various metabolic processes. The recombinant form refers specifically to the artificially produced version of this protein, expressed in laboratory conditions using genetic engineering techniques to enable detailed biochemical and functional studies.

Evolutionary Conservation

PEX16 demonstrates significant evolutionary conservation across eukaryotic species, indicating its fundamental role in cellular metabolism. While specific sequence homology data is not provided in the search results, functional studies across different organisms reveal conserved roles in peroxisome biogenesis. The Xenopus tropicalis variant provides researchers with a valuable model for studying this protein in a vertebrate system that bridges evolutionary gaps between simpler model organisms like yeast and more complex mammalian systems . This conservation underscores the protein's essential nature in eukaryotic cell biology and makes the Xenopus tropicalis recombinant form particularly valuable for comparative studies across species.

Expression Systems

Recombinant Xenopus tropicalis PEX16 can be produced using multiple expression platforms, each offering distinct advantages depending on research requirements. The most commonly documented system is in vitro E. coli expression, which provides high protein yields with relatively straightforward purification protocols . Alternative expression hosts include yeast systems, baculovirus-infected insect cells, mammalian cell cultures, and cell-free expression systems . Each system presents unique considerations regarding protein folding, post-translational modifications, and yield. For instance, E. coli systems typically offer cost-effective high-yield production but may lack certain eukaryotic post-translational modifications. In contrast, mammalian expression systems may provide more native-like protein modifications but with potentially lower yields and higher production costs.

Purification Methods and Purity Assessment

The purification of recombinant Xenopus tropicalis PEX16 follows standardized protocols centered on the protein's engineered features. The N-terminal 10xHis-tag enables efficient isolation through immobilized metal affinity chromatography, typically using nickel or cobalt resins that selectively bind the histidine residues . Commercial preparations report purity levels of 85% or greater as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . This analytical technique separates proteins based on molecular weight, allowing identification of the target protein and assessment of contaminant levels. The high purity level ensures reliability in downstream applications including functional assays, antibody production, and structural studies.

Role in Peroxisome Biogenesis

Recombinant Xenopus tropicalis PEX16 serves crucial functions in peroxisome biogenesis that appear conserved across species. PEX16 plays a fundamental role in the formation of nascent peroxisomes from the endoplasmic reticulum (ER), acting as an early factor in the peroxisome biogenesis pathway . Its unique characteristic of being inserted co-translationally into the ER membrane positions it to function as a pioneer protein in peroxisome formation . One of its primary functions is the targeting and insertion of peroxisomal membrane proteins, which are essential prerequisites for the subsequent import of matrix proteins and establishment of functional peroxisomes . Studies in various organisms have demonstrated that PEX16 deficiency leads to profound defects in peroxisome assembly, including impaired matrix protein import, abnormal peroxisome morphology, and severely compromised metabolic functions . These observations underscore PEX16's essential role as a peroxisomal membrane protein receptor and organizer.

Dual Localization Significance

A distinguishing feature of PEX16 is its unusual dual localization to both the endoplasmic reticulum and peroxisomal membranes . This characteristic is particularly significant as it positions PEX16 at the interface between these two organelles, facilitating the transfer of components necessary for peroxisome biogenesis. In the ER, PEX16 likely participates in the formation of pre-peroxisomal vesicles that eventually mature into functional peroxisomes . Within peroxisomal membranes, it continues to function in the growth and division of existing peroxisomes . This dual localization enables PEX16 to serve as a bridge between the initial stages of peroxisome formation at the ER and the maintenance of the mature peroxisomal population. The mechanism governing this distribution between organelles represents an important aspect of peroxisome biogenesis regulation, though the precise trafficking pathways remain to be fully elucidated in Xenopus tropicalis specifically.

Comparative Functional Analysis

Functional studies of PEX16 across different species reveal both conserved roles and species-specific adaptations. In Arabidopsis, PEX16 mutations produce phenotypes ranging from embryonic lethality (in the shrunken seed1 mutant) to viable plants with significant peroxisomal defects, indicating that even partial PEX16 function is crucial for organismal survival . These viable plant mutants exhibit slowed consumption of stored oil bodies, decreased import of matrix proteins, and increased peroxisome size, demonstrating PEX16's impact on multiple aspects of peroxisome function . In humans, mutations in PEX16 are associated with severe peroxisome biogenesis disorders, highlighting its essential role in human health . While the specific functional characteristics unique to Xenopus tropicalis PEX16 are not extensively documented in the provided search results, the conservation of fundamental roles across distant species suggests similar essential functions in this amphibian model organism, making it valuable for comparative studies.

Experimental Utility

Recombinant Xenopus tropicalis PEX16 serves as a versatile research tool with applications spanning multiple experimental approaches. The purified protein can be employed as an immunogen for antibody production, generating specific antibodies that enable detection, localization, and quantification of endogenous PEX16 in biological samples . These antibodies facilitate immunological techniques including Western blotting, immunoprecipitation, and immunofluorescence microscopy. The recombinant protein also enables in vitro binding assays to identify and characterize interactions with other peroxisomal proteins, helping to elucidate the molecular networks governing peroxisome biogenesis . Additionally, the availability of high-purity recombinant PEX16 supports the development of quantitative ELISA-based detection systems that allow precise measurement of PEX16 levels in experimental and clinical samples . These diverse applications make recombinant Xenopus tropicalis PEX16 a valuable resource for researchers investigating fundamental aspects of peroxisome biology.

Model Organism Advantages

The Xenopus tropicalis model offers several distinct advantages for studying peroxisome biogenesis using recombinant PEX16. As an amphibian system, it provides a vertebrate model that bridges evolutionary gaps between invertebrate models and mammals, offering insights into both conserved mechanisms and vertebrate-specific adaptations in peroxisome formation . The developmental biology of Xenopus tropicalis, with its well-characterized embryogenesis and metamorphosis, creates unique opportunities to study peroxisome biogenesis in the context of dramatic developmental transitions. Additionally, the diploid genome of Xenopus tropicalis (unlike the pseudotetraploid Xenopus laevis) facilitates genetic analyses and manipulations relevant to peroxisome research. These characteristics position Xenopus tropicalis PEX16 as a valuable model for comparative studies with human PEX16, potentially providing insights relevant to peroxisome biogenesis disorders while offering experimental advantages not available in mammalian systems.

Comparative Analysis Tool

Recombinant Xenopus tropicalis PEX16 enables valuable comparative studies across species that illuminate the evolution and functional conservation of peroxisome biogenesis systems. By comparing PEX16 structure, function, and interaction networks between Xenopus tropicalis and other organisms such as plants, yeasts, and mammals, researchers can identify core conserved mechanisms as well as species-specific adaptations . These comparative approaches help define essential functional domains and regulatory regions within the protein. Cross-species complementation experiments, in which Xenopus tropicalis PEX16 is expressed in mutants of other species lacking functional PEX16, provide particularly powerful insights into functional conservation and divergence. Such studies have revealed both similarities and differences in PEX16 function across eukaryotes, contributing to a more nuanced understanding of peroxisome biogenesis evolution . This comparative perspective enhances the value of Xenopus tropicalis PEX16 as a research tool beyond its direct relevance to amphibian biology.

Handling Recommendations

Proper handling of recombinant Xenopus tropicalis PEX16 is essential to maintain protein integrity and functionality. The following recommendations should be observed:

  1. Temperature management: Maintain cold chain during all handling procedures to prevent protein denaturation. Working aliquots can be stored at 4°C for up to one week, while longer-term storage requires freezing at -20°C or -80°C .

  2. Aliquoting protocol: Before freezing, divide the protein solution into single-use aliquots to avoid repeated freeze-thaw cycles, which significantly compromise protein integrity .

  3. Thawing procedure: Thaw frozen aliquots rapidly at room temperature or in a refrigerated environment, but avoid elevated temperatures that could denature the protein.

  4. Buffer considerations: When designing experiments, consider the buffer composition in which the recombinant protein is provided, as this may affect compatibility with specific assay conditions.

  5. Tag implications: Account for the presence of the N-terminal 10xHis-tag in experimental design, particularly for studies involving the protein's N-terminus or where tag interference might be a concern .

Adherence to these handling guidelines ensures optimal preservation of recombinant PEX16 activity and structural integrity throughout experimental procedures.

Functional Validation Methods

To confirm that recombinant Xenopus tropicalis PEX16 retains its native functionality, several validation approaches can be employed:

  1. SDS-PAGE analysis: Confirms protein purity and molecular weight, typically showing ≥85% purity in commercial preparations .

  2. Western blot detection: Using anti-PEX16 or anti-His-tag antibodies verifies protein identity and integrity.

  3. Binding assays: In vitro interaction studies with known PEX16 binding partners can confirm functional protein conformation.

  4. Complementation experiments: Expression of the recombinant protein in PEX16-deficient cells can demonstrate functional rescue of peroxisome biogenesis.

  5. Membrane association assays: Tests for appropriate integration into lipid bilayers can verify the protein's ability to associate with membranes as expected for a transmembrane protein.

These validation methods ensure that the recombinant protein maintains the functional characteristics necessary for reliable experimental outcomes and accurate biological interpretations.

Evolutionary Conservation Patterns

PEX16 demonstrates significant functional conservation across diverse eukaryotic lineages, though with notable species-specific adaptations. The table below compares key aspects of PEX16 across different organisms:

While detailed domain structure information specific to Xenopus tropicalis PEX16 is limited in the search results, comparative studies across species suggest conservation of key functional regions. These likely include transmembrane domains for membrane integration, protein interaction surfaces for recruiting other peroxins, and targeting signals for appropriate localization to both the ER and peroxisomes . Studies in Arabidopsis have demonstrated that mutations affecting different regions of the PEX16 gene produce distinct phenotypes, suggesting functional specialization within the protein's structure . This observation indicates that specific domains may have evolved to perform particular aspects of PEX16's multifaceted roles in peroxisome biogenesis. Further detailed structural analysis of the Xenopus tropicalis protein would provide valuable insights into the conservation and potential specialization of these functional domains in vertebrate systems.

Model System Contributions

The Xenopus tropicalis model system offers unique contributions to understanding PEX16 function in vertebrates. As an amphibian with a well-characterized developmental program, it provides opportunities to study peroxisome biogenesis in the context of significant developmental transitions not accessible in other model systems . The availability of recombinant Xenopus tropicalis PEX16 enables sophisticated biochemical analyses that complement genetic and cell biological approaches. Additionally, the evolutionary position of amphibians between fish and mammals creates valuable comparative opportunities for understanding vertebrate-specific aspects of peroxisome biology. While human studies naturally focus on disease-related aspects of PEX16 function, the Xenopus model allows exploration of fundamental biological questions without immediate clinical constraints. Together, these attributes position Xenopus tropicalis PEX16 research to make unique contributions to the broader understanding of peroxisome biogenesis across eukaryotes.

Protein Interaction Network Mapping

A comprehensive characterization of the protein interaction network surrounding Xenopus tropicalis PEX16 represents another promising research direction. Advanced proteomics approaches, including affinity purification coupled with mass spectrometry, could identify the complete set of proteins that physically interact with PEX16 in different cellular contexts. Techniques such as proximity labeling would further reveal proteins that associate transiently or function in close proximity to PEX16 without direct binding. These approaches would help define the molecular complexes in which PEX16 participates at different stages of peroxisome biogenesis. Comparative interaction studies across developmental stages or different tissues could reveal context-specific interaction patterns that regulate PEX16 function. Such detailed interaction maps would provide invaluable insights into how PEX16 coordinates with other cellular components to orchestrate peroxisome formation, maintenance, and proliferation.

Developmental Regulation Studies

The Xenopus tropicalis model offers unique opportunities to investigate developmental regulation of PEX16 expression and function. Future studies could examine how PEX16 levels, localization, and activity change during critical developmental transitions such as embryogenesis, organogenesis, and metamorphosis. These investigations could reveal tissue-specific regulation patterns and identify developmental stages particularly dependent on optimal peroxisome function. Techniques combining recombinant protein tools with developmental biology approaches—such as stage-specific protein expression analysis, tissue-specific knockdown, and rescue experiments using the recombinant protein—would provide comprehensive insights into PEX16's developmental roles. Additionally, studying how environmental factors and metabolic states influence PEX16 expression during development could reveal regulatory mechanisms with potential relevance to human health and disease. These developmental perspectives would complement molecular and cellular studies to create a multi-dimensional understanding of PEX16 biology.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please specify your preference in the order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize its development.
Synonyms
pex16; Peroxisomal membrane protein PEX16; Peroxin-16; Peroxisomal biogenesis factor 16
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-340
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
pex16
Target Protein Sequence
MAARYWDKLQDLSQKYKDYVIQNPTGATQLESAVRMLSYLIAGRFADSHELSELVYSASN LLALLNDGILRKELLAPPPTEGSRRRLLTWLGVLESLEVFIEIGAARAWGDRTRWAAILI IQLLKACLRIVLLFWYRAGIQSSPPVTPLDREGILNQAEDNSNSGSSCFVGRRSSRAVRS LDDSASSHRRFWRSPQIHDGKQRNTGETESDKDGSELGTLGTLAEAIHILRPITHLLSLA TWGQKSWKPWMVAAALDITSISLLSDVRNLSHRERAELRRRMFLLLYYLLRSPFYNHYTE TRLLLLLRLLGDYVPGVGLVARPLMDYLPVWQKIYFYNWG
Uniprot No.

Target Background

Function
This protein plays a role in peroxisome biogenesis.
Database Links

KEGG: xtr:100145130

UniGene: Str.8967

Protein Families
Peroxin-16 family
Subcellular Location
Peroxisome membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.