Recombinant Xenopus tropicalis Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y (pigy)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference point for customers.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pigy; Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y; Phosphatidylinositol-glycan biosynthesis class Y protein; PIG-Y
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-71
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
pigy
Target Protein Sequence
PVILWDPSLLPTDNKTQSSIKLKWGTYQEMLRHKCWLNGKAPKADLGCTEIHHQEWCKMA
Uniprot No.

Target Background

Function
This protein is part of the glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex. It catalyzes the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, playing a crucial role in the initial step of GPI biosynthesis. It potentially regulates the catalytic subunit PIGA.
Database Links

KEGG: xtr:496649

UniGene: Str.88209

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

What is the functional role of PIGY in phosphatidylinositol biosynthesis, and how is it experimentally validated?

PIGY is an essential subunit of the phosphatidylinositol N-acetylglucosaminyltransferase (GPIT) complex, which catalyzes the first step in glycosylphosphatidylinositol (GPI) anchor biosynthesis. This involves transferring N-acetylglucosamine (GlcNAc) to phosphatidylinositol (PI) to form GlcNAc-PI . Experimental validation typically involves:

  • Knockout Studies: Disruption of pigy in X. tropicalis embryos via CRISPR/Cas9 results in developmental arrest due to impaired GPI-anchored protein trafficking .

  • Biochemical Assays: Recombinant PIGY produced in insect or mammalian cells is purified and assayed for enzymatic activity using radiolabeled UDP-GlcNAc and PI substrates. Activity is quantified via thin-layer chromatography (TLC) or mass spectrometry .

How is recombinant X. tropicalis PIGY expressed and purified for in vitro studies?

Recombinant PIGY is typically expressed in E. coli or eukaryotic systems (e.g., HEK293 cells) with affinity tags (e.g., His-tag) for purification . Key steps include:

  • Expression Optimization: Codon optimization for X. tropicalis sequences in heterologous systems.

  • Purification: Immobilized metal affinity chromatography (IMAC) followed by size-exclusion chromatography to ensure monodispersity.

  • Quality Control: SDS-PAGE, Western blotting, and enzymatic activity assays to confirm functionality .

What assays are used to measure PIGY enzymatic activity, and how are potential inhibitors identified?

  • Primary Assay: Incorporation of 14C^{14}\text{C}-GlcNAc into PI, monitored via TLC or scintillation counting .

  • Secondary Assay: Fluorescence-based detection using synthetic PI analogs (e.g., BODIPY-PI).

  • Inhibitor Screening: High-throughput screening (HTS) of small-molecule libraries with dose-response validation (IC50_{50} determination) .

Advanced Research Questions

How can CRISPR/Cas9-mediated pigy knockout in X. tropicalis resolve contradictory findings about GPIT complex assembly?

Discrepancies in GPIT subunit interactions (e.g., PIGY vs. PIGX) arise from overexpression artifacts in mammalian systems. X. tropicalis offers advantages:

  • Endogenous Editing: CRISPR/Cas9 introduces frameshift mutations in pigy, enabling analysis of GPIT stability via co-immunoprecipitation (Co-IP) in native environments .

  • Gynogenetic Mapping: Homozygous mutants generated via gynogenesis clarify whether phenotypes stem from GPIT dysfunction or secondary mutations .

What strategies address low yield or instability of recombinant PIGY in structural studies?

  • Thermostabilization: Introduce point mutations (e.g., Proline substitutions) to rigidify flexible regions, guided by molecular dynamics simulations.

  • Membrane Mimetics: Use lipid nanodiscs or detergent screens (e.g., DDM, LMNG) to stabilize the transmembrane domain .

  • Crystallography: In meso crystallization with lipidic cubic phases for membrane protein structures .

How do phosphoinositide phosphatase activities (e.g., VSPs) confound PIGY functional assays, and how is this controlled?

Voltage-sensitive phosphatases (VSPs) in Xenopus oocytes dephosphorylate PI(3,4,5)P3_3 and PI(4,5)P2_2, altering substrate availability for PIGY . Mitigation strategies:

  • Pharmacological Inhibition: Pretreatment with pervanadate (100 µM, 30 min) to inhibit endogenous phosphatases .

  • Substrate Engineering: Use phosphatase-resistant PI analogs (e.g., methyl-phosphonate PI) .

Methodological Challenges and Solutions

How are tissue-specific GPI anchoring defects analyzed in pigy mutants without embryonic lethality?

  • Conditional Knockout: CRISPR/Cas9 with tissue-specific promoters (e.g., sox17 for endoderm) enables survival to later stages .

  • Mosaic Analysis: Co-injection of Cas9, pigy sgRNA, and lineage tracer (e.g., fluorescent dextran) identifies cell-autonomous effects .

What computational tools predict PIGY interaction partners or substrate-binding pockets?

  • AlphaFold-Multimer: Predicts GPIT complex architecture (PIGY-PIGA-PIGH interactions) .

  • Molecular Docking: Screens for UDP-GlcNAc analogs using AutoDock Vina with PIGY homology models .

Data Interpretation and Contradictions

Why do some studies report PIGY-independent GPIT activity in vitro, and how is this reconciled?

  • Artifactual Assembly: Overexpression of PIGA/PIGH in bacterial systems may form incomplete complexes with residual activity. Validate via:

    • Native PAGE: Compare oligomeric states of recombinant GPIT ± PIGY.

    • Activity per Complex: Single-molecule enzymology (e.g., fluorescence correlation spectroscopy) .

How do species-specific differences in PIGY orthologs impact translational research?

  • Functional Complementation: Human PIGY rescues GPI anchoring in X. tropicalis pigy mutants only if co-expressed with human PIGA/PIGH, indicating co-evolution of subunits .

  • Divergent Residues: Alignment identifies non-conserved regions (e.g., C-terminal tail) for mutagenesis to pinpoint functional domains .

Key Data Tables

Table 1. Comparison of PIGY Expression Systems

SystemYield (mg/L)Activity (nmol/min/mg)AdvantagesLimitations
E. coli2–510–20Low cost, rapidInsoluble aggregates
HEK2930.5–150–100Proper folding, PTMsHigh cost, scalability issues
Insect cells1–230–60Post-translational modificationTime-consuming

Table 2. Common Artifacts in PIGY Functional Assays

Artifact SourceSolution
Endogenous VSPs in Xenopus oocytesUse phosphatase inhibitors (e.g., pervanadate)
GPIT subunit overexpressionTitrate plasmid ratios to match endogenous levels
Non-specific lipid bindingInclude excess unlabeled PI in assays

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.