Recombinant Xenopus tropicalis Phosphatidylserine synthase 2 (ptdss2)

Shipped with Ice Packs
In Stock

Description

Overview of Phosphatidylserine

Phosphatidylserine (PS) represents a vital phospholipid component comprising approximately 5 to 10% of cellular membrane phospholipids. Beyond its structural role in membrane architecture, PS participates in numerous essential physiological processes including cell signaling pathways, blood coagulation mechanisms, and programmed cell death (apoptosis) . The distribution of PS within cell membranes is highly regulated, with PS predominantly enriched in the cytosolic leaflet of the plasma membrane and certain intracellular organelles . This asymmetric distribution is crucial for maintaining cellular homeostasis and enabling specific membrane-dependent functions. PS serves as a recognition signal for various cellular events, particularly during apoptosis where its externalization to the outer leaflet of the plasma membrane marks cells for clearance by phagocytes, demonstrating the critical importance of controlled PS synthesis and localization .

Phosphatidylserine Synthase Classification

In mammalian systems, two distinct base-exchange enzymes are responsible for PS synthesis: Phosphatidylserine synthase-1 (PSS1) and Phosphatidylserine synthase-2 (PSS2 or PTDSS2) . These enzymes catalyze similar reactions but differ in their substrate preferences and specific mechanisms. PSS1 primarily substitutes serine for choline in phosphatidylcholine, while PSS2 replaces the ethanolamine group of phosphatidylethanolamine with serine . Both enzymes predominantly localize to the mitochondria-associated membranes of the endoplasmic reticulum, which represents a crucial site for phospholipid biosynthesis and interorganellar communication . The Xenopus tropicalis ptdss2 enzyme shares functional similarities with its mammalian counterparts, reflecting evolutionary conservation of this essential metabolic pathway across vertebrate species.

Enzymatic Mechanism and Regulation

Phosphatidylserine synthase 2 functions through a calcium-dependent base-exchange reaction (EC 2.7.8.29) . The enzyme catalyzes the exchange of L-serine for the polar head group of phosphatidylethanolamine, effectively converting one phospholipid species to another without altering the fatty acid composition or glycerol backbone . This enzymatic activity is crucial for maintaining appropriate phospholipid compositions in various cellular membranes. Regulation of ptdss2 activity directly influences PS levels, which subsequently affects membrane properties and cell signaling cascades. The regulation of ptdss2 appears to involve both transcriptional control mechanisms and post-translational modifications, though the specific regulatory pathways in Xenopus tropicalis have not been fully characterized in the available literature.

Protein Structure and Domains

While detailed structural information specific to Xenopus tropicalis ptdss2 is limited in the available search results, general characteristics can be inferred from homologous proteins. As a member of the phosphatidylserine synthase family, ptdss2 is expected to contain transmembrane domains that anchor it to the endoplasmic reticulum membrane, particularly in mitochondria-associated membrane regions . The protein likely possesses specific binding sites for its substrates (phosphatidylethanolamine and L-serine) and cofactors (calcium ions), which are essential for its catalytic activity. The enzyme's active site must accommodate the complex phospholipid substrate while enabling the precise exchange of head groups that characterizes its function.

Evolutionary Conservation

The presence of ptdss2 across diverse species including mammals, amphibians (such as Xenopus tropicalis), and fish indicates strong evolutionary conservation of this enzyme . This conservation suggests the fundamental importance of PS biosynthesis in eukaryotic cell function throughout evolutionary history. Comparative analyses of ptdss2 sequences from different species would likely reveal conserved catalytic domains and species-specific variations that might reflect adaptations to different physiological requirements or membrane compositions. The availability of recombinant forms from multiple species, including Xenopus tropicalis, facilitates such comparative studies.

Enzymatic Activities

The primary enzymatic activity of Xenopus tropicalis ptdss2 involves CDP-diacylglycerol-serine O-phosphatidyltransferase activity and broader transferase activity . These biochemical functions enable the enzyme to catalyze the base-exchange reaction that converts phosphatidylethanolamine to phosphatidylserine. The calcium dependency of this reaction is a defining characteristic of ptdss2 function, with calcium ions serving as essential cofactors for enzymatic activity . The recombinant form of the enzyme maintains these catalytic properties, making it valuable for in vitro studies of phospholipid metabolism and membrane biogenesis.

Metabolic Pathway Involvement

Xenopus tropicalis ptdss2 participates in several critical metabolic pathways, most notably glycerophospholipid metabolism and broader metabolic pathways involving membrane lipid synthesis . The table below illustrates some of the key pathways and related proteins involved:

Pathway NamePathway Related Proteins
Glycerophospholipid metabolismPLA2G2E, LPCAT4, DGKE, PLA2G15, PPAP2CB, CHATA, PLD1A, CHKB, CHAT, MBOAT1
Metabolic pathwaysUCK1, PYGM, MGAT1, GPIA, COQ3, SC5DL, INPP5K, PIP5KL1, PAPSS1, MTMR1

These pathway interactions highlight the integrated nature of ptdss2 function within broader cellular metabolic networks . The enzyme's activity influences not only phospholipid composition but also impacts numerous downstream processes dependent on proper membrane structure and phospholipid availability.

Expression Systems

Recombinant Xenopus tropicalis ptdss2 is primarily produced using cell-free expression systems, which offer advantages for membrane protein production by avoiding potential toxicity issues associated with overexpression in cellular hosts . This approach allows for controlled synthesis of the enzyme under optimized conditions. Alternative expression systems documented for recombinant phosphatidylserine synthases include bacterial (E. coli), yeast, baculovirus, and mammalian cell expression platforms, each with distinct advantages for different research applications . The choice of expression system can significantly impact protein folding, post-translational modifications, and ultimately enzymatic activity.

Purification and Quality Assessment

Commercial preparations of recombinant Xenopus tropicalis ptdss2 typically achieve purities of 85% or greater as determined by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) . This high level of purity is essential for accurate biochemical characterization and functional studies. The purification process likely involves affinity chromatography or other protein separation techniques optimized for membrane-associated enzymes. Quality assessment procedures include SDS-PAGE analysis to confirm protein size and purity, along with activity assays to verify that the recombinant enzyme maintains its catalytic properties following the expression and purification processes.

Membrane Structure and Dynamics

The primary physiological role of ptdss2 relates to its contribution to membrane structure through phosphatidylserine synthesis. PS comprises approximately 5-10% of membrane phospholipids and significantly influences membrane properties including curvature, fluidity, and charge distribution . The negatively charged head group of PS creates an electrostatically distinct membrane environment that facilitates protein recruitment and membrane interactions. In Xenopus tropicalis, as in other vertebrates, proper PS distribution is likely essential for normal development and cellular function, though species-specific roles have not been extensively characterized in the available literature.

Cell Signaling and Physiological Processes

Phosphatidylserine generated by ptdss2 activity participates in various signaling pathways and physiological processes. PS serves as a binding site for proteins containing specific PS-binding domains, facilitating their recruitment to membrane surfaces where they can interact with other signaling molecules . Additionally, PS externalization to the outer leaflet of the plasma membrane serves as a signal for apoptotic cell recognition, while PS in specific intracellular compartments, such as recycling endosomes, contributes to membrane trafficking and protein sorting . Recent studies have revealed that PS in recycling endosomes plays a role in membrane traffic processes including vesicle formation and fission .

Subcellular Localization and Trafficking

The distribution of PS within cells is highly regulated and involves both vesicular trafficking and non-vesicular transport mechanisms . Phosphatidylserine synthases like ptdss2 localize primarily to the endoplasmic reticulum, particularly at mitochondria-associated membranes . Following synthesis, PS is transported to various cellular membranes where it performs specific functions. PS enrichment in the cytosolic leaflet of recycling endosomes has been linked to membrane traffic processes, including protein recycling to the plasma membrane and retrograde transport to the Golgi apparatus . The flipping of PS between membrane leaflets by ATP-dependent aminophospholipid translocases (flippases) further contributes to the precise subcellular distribution and function of PS in membrane dynamics .

Tools for Membrane Biology Research

Recombinant Xenopus tropicalis ptdss2 serves as a valuable tool for investigating fundamental aspects of membrane biology and phospholipid metabolism. The enzyme can be used in reconstitution experiments to study the mechanisms of PS synthesis and factors affecting enzymatic activity. Additionally, comparing ptdss2 from different species, including Xenopus tropicalis, provides insights into the evolution of phospholipid biosynthetic pathways and species-specific adaptations in membrane composition. The availability of purified recombinant enzyme facilitates these comparative studies and enables detailed biochemical characterization.

Phosphatidylserine Detection Systems

Research using phosphatidylserine synthases has contributed to the development of PS detection systems that have advanced our understanding of membrane biology. For example, evectin-2 PH domain and its tandem fusion (2xPH) have been used as probes to detect subcellular PS distribution in live and fixed cells . These detection systems have revealed that recycling endosomes are enriched in PS, with PS concentration in the cytosolic leaflet of recycling endosome membranes estimated around 40-50 mol% . Such tools provide valuable insights into the subcellular distribution and dynamics of PS in various cellular processes.

Potential Therapeutic Applications

Understanding the function of phosphatidylserine synthases like ptdss2 has potential implications for therapeutic development. Disruptions in PS synthesis and distribution have been linked to various pathological conditions, including neurodegenerative disorders and blood coagulation abnormalities . While specific therapeutic applications of Xenopus tropicalis ptdss2 are not directly addressed in the available search results, the fundamental knowledge gained from studying this enzyme contributes to our understanding of phospholipid metabolism and potential therapeutic targets in related pathways.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
ptdss2; Phosphatidylserine synthase 2; PSS-2; PtdSer synthase 2; Serine-exchange enzyme II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-474
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ptdss2
Target Protein Sequence
MLRSDVRRVAAGRKASLDGLYCEELEVRGNRNLGNKFSHRGELRSSTESEVFDDGTNTFF WRAHTLTVLFILTCSLGYVTLLEETPQDTAYNAKRGIIASILVFLCFGVTQAKDGPFSRP HPAYWRFWLCVSVVYELFLIFILFQTVHDGRQFMKFIDPKLGVPLPERDYGGNCLIYDPG NKTDPYHNLWDKMDGFVPAHFLGWYIKTLMIRDWWMCMIISVMFEFLEYSLEHQLPNFSE CWWDHWIMDVLVCNGFGIYCGMKTLEWLSMKPYKWQGLWNIPTYRGKMKRIAFQFTPYSW VKFEWKPASSLRRWLAVCGIIFVFLLAELNTFYLKFVLWMPPEHYLVLLRLVFFVNVGGV AMREIYDFMDDLKFHKKLGQQAWMVAAITVTEFLIVVKYDPYTITLPLPFYVTQCWILGI VLVLTWTVWRFFIRDITLRYKEIRQQKQHRNEEEKSHRNGDVNSEKDTNKHKKH
Uniprot No.

Target Background

Function
This enzyme catalyzes a base-exchange reaction where the polar head group of phosphatidylethanolamine (PE) or phosphatidylcholine (PC) is replaced by L-serine. It specifically catalyzes the conversion of phosphatidylethanolamine and does not act on phosphatidylcholine. The enzyme can utilize both phosphatidylethanolamine (PE) plasmalogen and diacyl PE as substrates, with the latter being six times more readily utilized. This indicates the significance of an ester linkage at the sn-1 position. While exhibiting no sn-1 fatty acyl preference, the enzyme demonstrates a strong preference for docosahexaenoic acid (22:6n-3) over 18:1 or 20:4 at the sn-2 position.
Database Links
Protein Families
Phosphatidyl serine synthase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis Phosphatidylserine synthase 2 (ptdss2)?

Phosphatidylserine synthase 2 (ptdss2) is an enzyme with EC number 2.7.8.29, also known as PSS-2, PtdSer synthase 2, or Serine-exchange enzyme II. In Xenopus tropicalis, this enzyme is encoded by the ptdss2 gene and plays a critical role in phospholipid biosynthesis. The full-length protein spans expression region 1-474 amino acids, with a complete amino acid sequence available for research applications .

Why use Xenopus tropicalis as a model organism for ptdss2 studies?

Xenopus tropicalis offers several advantages as a research model compared to other amphibian models like Xenopus laevis. X. tropicalis develops to sexual maturity in approximately 1/3 the time of X. laevis, has half the genome size (and is diploid rather than tetraploid), and requires only 1/5 the housing space . While maintaining similar embryological advantages to X. laevis, it allows for more efficient genetic analysis with the potential for generating haploid and gynogenetic diploid embryos, facilitating genetic screens with fewer resources than mouse genetics .

How does ptdss2 functionality in Xenopus tropicalis compare to mammalian models?

While the search results don't provide direct comparison between Xenopus tropicalis ptdss2 and mammalian equivalents, Xenopus models generally maintain a high degree of homology to higher vertebrate models. As noted with other Xenopus studies, many genes are sufficiently similar that probes cross-react between species . The African clawed frog has been used extensively as an efficient pre-clinical screening tool with substantial homology to higher vertebrate models used in research .

What are the optimal storage and handling conditions for recombinant Xenopus tropicalis ptdss2?

Recombinant Xenopus tropicalis ptdss2 should be stored at -20°C, and for extended storage, conserved at -20°C or -80°C. The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for this specific protein. Importantly, repeated freezing and thawing is not recommended as it may compromise protein integrity. For short-term work, store working aliquots at 4°C for up to one week .

How should experimental controls be designed when studying ptdss2 function?

When designing experiments to study ptdss2 function, researchers should consider both positive and negative controls. Based on methodologies used in similar Xenopus studies, appropriate controls might include untreated animal cap explants as negative controls and known inducers of phosphatidylserine synthesis as positive controls. For gene expression studies, orthogonal displacement complex (ODC) can be used as an internal control for normalizing expression levels, as demonstrated in other Xenopus research .

What expression systems are most effective for producing functional recombinant Xenopus tropicalis ptdss2?

While the search results don't specify the optimal expression system, the recombinant protein is available commercially with tag types determined during the production process . Common expression systems for Xenopus proteins include E. coli, baculovirus/insect cell systems, and mammalian cell lines. The choice depends on research requirements for post-translational modifications and protein folding integrity.

How can ptdss2 be utilized in developmental biology research?

Ptdss2 can be studied in the context of Xenopus tropicalis developmental biology using established techniques such as mRNA injection and whole-mount in situ hybridization . Researchers could investigate ptdss2 expression patterns during embryonic development, particularly during periods of rapid membrane synthesis and remodeling. The relationship between phospholipid metabolism and morphogenesis or organogenesis could be explored, as these are acknowledged key areas in developmental biology about which molecular mechanisms remain poorly understood .

What is the role of ptdss2 in phospholipid membrane dynamics during embryogenesis?

This specific question isn't directly addressed in the search results, but researchers could design experiments to track phosphatidylserine localization during embryogenesis using the recombinant protein as a standard or for generating antibodies. Animal cap assays, similar to those used in activin-response studies in Xenopus, could be adapted to investigate how ptdss2 activity affects membrane composition during tissue differentiation .

How does gene expression of ptdss2 compare between different developmental stages in Xenopus tropicalis?

While the search results don't provide specific information about ptdss2 expression during development, researchers could use techniques similar to those described for other genes. Real-time PCR could quantify ptdss2 expression at different developmental stages, similar to how chd, cer, and Xbra expressions were measured in activin-treated explants . This would help establish the temporal expression pattern of ptdss2 during Xenopus tropicalis development.

What techniques are available for measuring ptdss2 enzymatic activity?

Based on the enzyme's function (EC 2.7.8.29), researchers could measure ptdss2 activity by quantifying the conversion of phosphatidylcholine to phosphatidylserine. While not specified in the search results, common techniques might include thin-layer chromatography, mass spectrometry, or radioactive labeling to track substrate conversion. Researchers should optimize buffer conditions based on the storage buffer information provided: Tris-based buffer with 50% glycerol .

How can morpholino knockdown be used to study ptdss2 function in Xenopus tropicalis?

While not specifically mentioned for ptdss2, morpholino knockdown is a standard technique in Xenopus research. Researchers could design antisense morpholino oligonucleotides targeting ptdss2 mRNA, inject them into early embryos, and assess the resulting phenotypes. This approach would help determine the developmental consequences of reduced ptdss2 expression, similar to functional studies performed for other genes in Xenopus tropicalis .

What considerations should be taken when performing temperature-sensitive experiments with Xenopus tropicalis ptdss2?

Temperature is critical for signaling pathways in Xenopus studies. Based on related research, experiments involving Xenopus tropicalis should typically be conducted at 20-25°C. For developmental timing comparisons, 20°C allows gastrulation to proceed at comparable rates between Xenopus tropicalis and Xenopus laevis . For extended culture of explants, researchers have used 25°C for Xenopus tropicalis compared to 20°C for Xenopus laevis .

How should researchers normalize ptdss2 expression data in qPCR experiments?

Based on methodologies used in similar Xenopus research, ornithine decarboxylase (ODC) is an appropriate internal control for normalizing gene expression data . When designing qPCR experiments for ptdss2, researchers should:

  • Extract total RNA from relevant tissues

  • Perform reverse transcription with appropriate controls

  • Use ODC primers as the reference gene

  • Calculate relative expression using appropriate statistical methods

  • Present data as fold-change relative to control samples or specific developmental stages

What are the common pitfalls in interpreting ptdss2 functional analysis results?

While not specifically addressed for ptdss2, researchers should be aware of potential confounding factors when interpreting results:

  • Temperature sensitivity of enzymatic reactions

  • Species-specific differences in gene expression levels and timing

  • The possibility of maternal ptdss2 mRNA affecting early developmental studies

  • Potential cross-reactivity with other phosphatidylserine synthases

  • The differential induction responses observed between Xenopus tropicalis and Xenopus laevis for other genes might also apply to ptdss2

How can researchers accurately compare ptdss2 activity between Xenopus tropicalis and Xenopus laevis?

Based on comparative studies between these species, researchers should:

  • Conduct experiments at identical temperatures (20°C recommended)

  • Sample tissues at equivalent developmental stages rather than at the same time points

  • Be aware that gene expression levels may differ between species even when the dose-response relationship is similar

  • Use real-time PCR for quantitative comparisons, as demonstrated for other genes

  • Consider potential differences in maternal contribution and timing of zygotic gene activation

How conserved is ptdss2 across different Xenopus species and other vertebrates?

While specific information about ptdss2 conservation isn't provided in the search results, Xenopus tropicalis and Xenopus laevis gene sequences are generally sufficiently similar that probes cross-react between the two species . Researchers interested in evolutionary conservation could perform sequence alignments of ptdss2 across species. The complete amino acid sequence of Xenopus tropicalis ptdss2 provided in the search results could serve as a starting point for such comparisons .

How can transcription factor binding to the ptdss2 promoter be analyzed in Xenopus tropicalis?

Xenopus tropicalis has numerous identified transcription factors grouped by Pfam DNA-binding domains . Researchers could analyze the ptdss2 promoter region for binding sites corresponding to these transcription factors. Experimental approaches might include chromatin immunoprecipitation (ChIP), electrophoretic mobility shift assays (EMSA), or reporter gene assays with promoter constructs. The database of Xenopus tropicalis transcription factors could guide the selection of candidate regulators for experimental validation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.