Recombinant Xenopus tropicalis Post-GPI attachment to proteins factor 2 (pgap2)

Shipped with Ice Packs
In Stock

Description

Biological Function and Mechanism

PGAP2 facilitates fatty acid remodeling of GPI anchors during Golgi transport, ensuring stable cell-surface expression of GPI-APs. Key functional insights include:

  • Role in GPI-AP Stability: PGAP2 replaces unsaturated fatty acids with stearic acid in GPI anchors, preventing cleavage by phospholipases and subsequent protein shedding .

  • Deficiency Effects: Loss of PGAP2 leads to lyso-GPI-AP accumulation, resulting in protein secretion rather than membrane retention .

Pathological Relevance:

  • Mutations in PGAP2 are linked to hyperphosphatasia with intellectual disability (HPMRS3), characterized by elevated alkaline phosphatase and neurodevelopmental deficits .

  • Functional rescue experiments in PGAP2-deficient cells demonstrate its necessity for restoring GPI-AP surface localization .

3.1. Protein Expression Systems

Recombinant pgap2 is utilized in molecular switching systems to regulate GPI-AP secretion:

  • Surface Display and Secretion: Co-expression with GPI-anchored therapeutics (e.g., lysosomal enzymes) allows cell sorting via surface markers. Subsequent PGAP2 knockout triggers protein release into the medium, streamlining high-yield production .

3.2. Disease Modeling

  • Neurological Disorders: Used to study HPMRS3 pathogenesis, particularly how GPI-AP deficiencies impair neuronal development .

  • Functional Assays: Reconstitution experiments in mutant cell lines validate the impact of PGAP2 variants on GPI-AP stability .

Research Limitations and Future Directions

  • Structural Studies: The exact lipid-binding mechanism of PGAP2 remains unresolved, necessitating cryo-EM or X-ray crystallography studies .

  • Therapeutic Potential: Further exploration is needed to assess PGAP2’s role in enzyme replacement therapies for GPI-anchor disorders .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice packaging is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
pgap2; Post-GPI attachment to proteins factor 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-252
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
pgap2
Target Protein Sequence
MVPVGPERGANSLFSLRFTTFAVGTVSLPLFAFLFCIVWSLLFNFSETTATHCHVPNYLP SVSAAIGGETPQRYIWRLCIGLHSAPRFLVGVAYLHYYQGTPCSSPAYPRLCHLNFLLNC CEIFFLILLTYVSSSENYEVHKLGFMAFMLFSVGYMFVTCSLWRVARKGSGSLEERTSYA WKKRLFGFYLLMFLSSILVYIWHNMYCEAGVYTVFALLEYLVVLSNMGFHMTAWWDFGNK ELMICSPGDKRI
Uniprot No.

Target Background

Function
This protein is involved in the lipid remodeling steps of GPI-anchor maturation. It is essential for the stable expression of GPI-anchored proteins at the cell surface.
Database Links

KEGG: xtr:100127662

UniGene: Str.39207

Protein Families
PGAP2 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of PGAP2 in Xenopus tropicalis?

PGAP2 (Post-GPI Attachment to Proteins Factor 2) in Xenopus tropicalis is a 252 amino acid protein with a Frag1 (FGF receptor activating) domain . The protein sequence includes a highly conserved region that functions in GPI (glycosylphosphatidylinositol) anchor modification of proteins. Structurally, PGAP2 contains multiple transmembrane domains and is involved in the lipid remodeling of GPI-anchored proteins (GPI-APs), which is critical for proper membrane localization and function of these proteins . The amino acid sequence of X. tropicalis PGAP2 shows significant conservation with orthologs across vertebrates, indicating evolutionary importance of this protein's function .

How conserved is PGAP2 across species compared to Xenopus tropicalis?

PGAP2 is remarkably conserved throughout evolution, demonstrating its fundamental biological importance . Multiple sequence alignment (MSA) analyses of PGAP2 orthologs from various species including Danio rerio, Xenopus tropicalis, Rattus norvegicus, Mus musculus, Pan troglodytes, Bos taurus, Homo sapiens, and Canis lupus familiaris reveal high sequence similarity, particularly in functional domains . The conservation is especially evident in the Frag1 domain where functionally critical residues like the arginine at position 185 (subject to pathogenic mutation in humans) are maintained across species . This high degree of conservation makes Xenopus tropicalis PGAP2 a valuable research model for understanding the protein's function in vertebrate development and disease mechanisms.

What is the expression pattern of PGAP2 in Xenopus tropicalis tissues?

While specific expression data for Xenopus tropicalis is limited in the available literature, comparative analysis with human PGAP2 expression patterns provides insight. In humans, PGAP2 shows ubiquitous expression across tissues but with notably higher transcription levels in brain, cerebellum, skeletal muscle, heart, fetal liver, and placenta . Given the high conservation of PGAP2 across species, similar tissue-specific expression patterns might be expected in Xenopus tropicalis, with particular enrichment in neural and muscle tissues during development. Understanding these expression patterns is crucial for designing tissue-specific experiments in X. tropicalis to investigate PGAP2 function in different developmental contexts.

What are effective methods for studying PGAP2 function in Xenopus tropicalis?

Several methodological approaches can be employed to study PGAP2 function in Xenopus tropicalis:

  • Antisense Morpholino Oligonucleotides (MOs): MOs designed to complement sequence between -80 and +25 bases of the initiating AUG codon of PGAP2 mRNA can effectively knockdown gene expression . When designing MOs, researchers should:

    • Target the translation start site region

    • Validate specificity by using non-overlapping MOs

    • Perform rescue experiments with PGAP2 mRNA lacking the MO binding site

  • RT-PCR Analysis: For expression studies, RT-PCR can be performed using primers specific to X. tropicalis PGAP2 transcripts to analyze temporal and spatial expression patterns .

  • Recombinant Protein Studies: Utilizing purified recombinant PGAP2 protein for in vitro analyses of protein interactions and biochemical function .

  • CRISPR/Cas9 Gene Editing: For generating stable knockout or knock-in lines to study long-term developmental consequences of PGAP2 mutation or loss.

Each approach has specific advantages for addressing different research questions about PGAP2 function.

How should recombinant Xenopus tropicalis PGAP2 protein be properly stored and handled for experiments?

For optimal stability and activity, recombinant Xenopus tropicalis PGAP2 protein should be stored in Tris-based buffer with 50% glycerol at -20°C, and for extended storage, at -80°C . Researchers should avoid repeated freeze-thaw cycles as these can compromise protein integrity and activity . When working with the protein, it's advisable to:

  • Prepare working aliquots that can be stored at 4°C for up to one week

  • Thaw frozen protein samples on ice to minimize degradation

  • Centrifuge briefly before opening tubes to collect contents

  • Use appropriate protein-stabilizing additives when diluting stock solutions

  • Validate protein activity before critical experiments

Following these handling procedures will help maintain the structural integrity and functional activity of the recombinant protein for reliable experimental results.

What primer designs are most effective for PGAP2 amplification in Xenopus tropicalis?

Based on published research methodologies, effective primers for PGAP2 amplification in Xenopus tropicalis should target conserved regions of the gene while ensuring specificity. Although specific primers for X. tropicalis PGAP2 are not directly provided in the available literature, researchers can design effective primers by:

  • Analyzing the X. tropicalis PGAP2 sequence (UniProt A8KBG2) for unique regions

  • Targeting exon junctions to avoid genomic DNA amplification

  • Designing primers with appropriate GC content (40-60%) and melting temperatures

For reference, human PGAP2 has been successfully amplified using primers:
Forward: 5'-AAACAGCGGCTCTTCATCAT-3'
Reverse: 5'-CAAGCAGGACTGAAGGGTTC-3'

These produce a 237bp amplicon and could serve as a starting point for designing X. tropicalis-specific primers after sequence alignment and modification. PCR conditions typically include annealing temperatures around 58-60°C with 30-35 cycles for optimal amplification .

What developmental pathways interact with PGAP2 in early Xenopus development?

PGAP2, as a post-GPI attachment protein factor, likely plays critical roles in multiple developmental pathways in Xenopus tropicalis. While specific pathway interactions in X. tropicalis require further investigation, several potential developmental roles can be inferred based on conserved functions:

  • Neural Development: High expression in brain tissues suggests involvement in neurogenesis, neuronal migration, or synaptogenesis .

  • GPI-Anchored Protein Regulation: PGAP2 mediates proper cell surface expression of numerous GPI-anchored proteins that function in:

    • Cell adhesion and migration

    • Morphogen gradient formation

    • Signal transduction

    • Extracellular matrix interaction

  • Embryonic Patterning: Potential interactions with morphogen pathways like Wnt, FGF, and BMP that rely on properly functioning GPI-anchored co-receptors.

Researchers utilizing the "synphenotype group" approach in X. tropicalis can identify genes that, when knocked down, produce similar phenotypes to PGAP2 disruption, potentially revealing functional pathways . This method has proven valuable for discovering developmental pathway interactions in large-scale screens.

What is the relationship between PGAP2 function and alkaline phosphatase levels in different model systems?

A key diagnostic feature of PGAP2 dysfunction in humans is hyperphosphatasia (elevated alkaline phosphatase levels), and this relationship appears to be conserved across species . This relationship stems from PGAP2's role in GPI anchor modification:

  • PGAP2 normally facilitates the fatty acid remodeling of GPI anchors, which is crucial for proper membrane localization of GPI-anchored proteins, including alkaline phosphatase.

  • When PGAP2 function is compromised, GPI-anchored proteins including alkaline phosphatase may be improperly processed, leading to their abnormal release from cell membranes into circulation, resulting in elevated serum levels.

  • Even heterozygous carriers of PGAP2 mutations display slightly elevated alkaline phosphatase levels, indicating a dose-dependent relationship .

For researchers using Xenopus tropicalis as a model system, measuring alkaline phosphatase activity could serve as a functional readout of PGAP2 manipulation, providing a quantitative biomarker for assessing interventions. This enzyme-based assay can be adapted for high-throughput screening of compounds that might rescue PGAP2 dysfunction.

What validation strategies confirm specificity when using morpholinos to target PGAP2 in Xenopus tropicalis?

When using morpholino oligonucleotides (MOs) to knock down PGAP2 in Xenopus tropicalis, researchers should implement multiple validation strategies to confirm specificity and rule out off-target effects:

  • Multiple Non-overlapping MOs: Design and test different MOs targeting distinct regions of PGAP2 mRNA. If these produce similar phenotypes, it strongly suggests specific targeting of PGAP2 rather than off-target effects .

  • Control MOs: Include 5-base mismatch MOs as negative controls. These should differ from the experimental MO by five nucleotides and ideally not produce the same phenotype .

  • Rescue Experiments: Co-inject PGAP2 mRNA lacking the MO binding site along with the MO. Phenotypic rescue confirms specificity of the knockdown .

  • Dose-Response Relationship: Establish a clear dose-response curve with increasing MO concentrations.

  • Molecular Validation: Confirm reduced PGAP2 protein levels using Western blot or reduced transcript by RT-PCR when using splice-blocking MOs.

These validation methods are essential for attributing observed phenotypes specifically to PGAP2 knockdown rather than non-specific effects or toxicity of the morpholinos.

How can researchers optimize expression and purification of recombinant Xenopus tropicalis PGAP2?

Optimizing expression and purification of recombinant Xenopus tropicalis PGAP2 requires careful consideration of several factors:

Expression System Selection:

  • Bacterial Systems: May be challenging due to PGAP2's multiple transmembrane domains and potential requirement for post-translational modifications

  • Eukaryotic Systems: Insect cells (Sf9, High Five) or mammalian cells (HEK293, CHO) are preferable for preserving structural integrity and function

Optimization Strategies:

  • Vector Design: Include appropriate tags (His, GST, or MBP) for purification while minimizing interference with function

  • Expression Conditions:

    • Temperature: Often lower temperatures (16-30°C) improve folding

    • Induction timing and concentration

    • Culture media optimization

Purification Protocol:

  • Initial capture using affinity chromatography

  • Secondary purification using size exclusion or ion exchange chromatography

  • Buffer optimization with stabilizing additives

Quality Control:

  • SDS-PAGE and Western blotting to confirm purity and identity

  • Mass spectrometry for sequence verification

  • Functional assays to confirm activity of purified protein

For membrane-associated proteins like PGAP2, inclusion of appropriate detergents or lipid nanodiscs in purification buffers may be necessary to maintain proper folding and function.

What comparative genomic approaches can identify functional domains in Xenopus tropicalis PGAP2?

Researchers can employ several comparative genomic approaches to identify and characterize functional domains in Xenopus tropicalis PGAP2:

  • Multiple Sequence Alignment (MSA): Align PGAP2 sequences across diverse species to identify highly conserved regions that likely represent functional domains . Tools like Clustal Omega can be used for this purpose.

  • Conservation Scoring: Apply algorithms such as ConSurf or GERP to quantify evolutionary conservation at each amino acid position, highlighting functionally significant residues.

  • Domain Prediction Tools: Utilize protein domain databases and prediction tools (Pfam, InterPro, SMART) to identify known functional domains like the Frag1 domain in PGAP2 .

  • Structural Homology Modeling: Generate 3D structural models based on homologous proteins with known structures to predict functional interfaces and important structural elements.

  • Synteny Analysis: Examine gene organization and orientation around PGAP2 across species to identify conserved genomic contexts that might suggest functional relationships.

These approaches can guide the design of targeted mutagenesis experiments, focusing on highly conserved residues likely to be functionally significant, such as the arginine at position 185 known to be pathogenic when mutated in humans .

How should researchers interpret phenotypic variations in PGAP2 knockdown experiments in Xenopus tropicalis?

When interpreting phenotypic variations in PGAP2 knockdown experiments in Xenopus tropicalis, researchers should consider several key factors:

  • Dosage Effects: Different concentrations of morpholinos or varying degrees of CRISPR-mediated mutation may produce a spectrum of phenotypes. Establish clear dose-response relationships to distinguish partial from complete loss of function .

  • Temporal Considerations: Document and analyze phenotypes at multiple developmental stages as PGAP2 may have different functions throughout development.

  • Tissue-Specific Effects: Given PGAP2's differential expression across tissues, carefully document effects in:

    • Neural tissues

    • Skeletal/muscle development

    • Liver and metabolic tissues

    • GPI-anchored protein-rich tissues

  • Quantitative Phenotyping: Implement quantitative metrics rather than qualitative descriptions:

    • Morphometric measurements

    • Cell behavior quantification

    • Biochemical assays (e.g., alkaline phosphatase activity)

    • Gene expression changes

  • Classification into Synphenotype Groups: Compare with phenotypes from knockdown of other genes to identify potential functional relationships and pathways .

This systematic approach to phenotypic analysis helps distinguish specific PGAP2-related effects from general developmental disruptions and facilitates comparisons across experiments and research groups.

What statistical approaches are recommended for analyzing PGAP2 expression data across developmental stages?

When analyzing PGAP2 expression data across developmental stages in Xenopus tropicalis, researchers should consider the following statistical approaches:

  • Normalization Methods:

    • Use multiple reference genes (e.g., GAPDH, EF1α, ODC) for RT-PCR/qPCR normalization

    • Apply appropriate normalization for RNA-seq data (FPKM, TPM, or DESeq2 normalization)

    • Consider stage-specific reference genes as expression stability may vary

  • Time-Series Analysis:

    • ANOVA with post-hoc tests for comparing multiple developmental stages

    • Mixed-effects models to account for batch effects and biological variability

    • Time-series clustering to identify genes with similar expression patterns

  • Visualization Approaches:

    • Heatmaps for comparing PGAP2 with related genes across stages

    • Principal Component Analysis to identify major sources of variation

    • Trajectory analysis for visualizing developmental progression

  • Differential Expression Analysis:

    • Calculate fold changes between consecutive developmental stages

    • Implement false discovery rate correction for multiple testing

    • Use stage-matched controls for all comparisons

  • Integration with Phenotypic Data:

    • Correlation analysis between expression levels and phenotypic metrics

    • Regression models to identify predictive relationships

These approaches provide robust frameworks for quantifying and interpreting PGAP2 expression changes throughout development, enabling the identification of critical developmental windows where PGAP2 function may be particularly important.

How can researchers distinguish between direct and indirect effects of PGAP2 manipulation in developmental studies?

Distinguishing between direct and indirect effects of PGAP2 manipulation represents a significant challenge in developmental studies. Researchers should implement a multi-faceted approach:

  • Temporal Analysis:

    • Conduct fine-grained temporal analysis to establish the sequence of events following PGAP2 disruption

    • Early effects are more likely to be direct consequences while later effects may represent secondary adaptations

  • Tissue-Specific Manipulation:

    • Use tissue-specific or inducible knockdown/knockout systems to isolate PGAP2 function in specific contexts

    • Compare phenotypes between global and tissue-specific manipulations

  • Molecular Profiling:

    • Perform RNA-seq at multiple time points after PGAP2 manipulation to identify immediate early gene responses versus later transcriptional changes

    • Conduct proteomic analysis focusing on GPI-anchored proteins that are directly affected by PGAP2 function

  • Rescue Experiments:

    • Design targeted rescue experiments that restore specific aspects of PGAP2 function

    • Use chimeric proteins to isolate functional domains

  • Pathway Analysis:

    • Implement epistasis experiments by manipulating potential downstream effectors simultaneously with PGAP2

    • Use small molecule inhibitors of suspected pathway components to verify their involvement

This methodical approach helps construct a causal framework distinguishing primary effects directly attributable to PGAP2 function from secondary consequences resulting from developmental compensation or disruption of dependent processes.

What emerging technologies could advance understanding of PGAP2 function in Xenopus tropicalis?

Several cutting-edge technologies hold promise for deepening our understanding of PGAP2 function in Xenopus tropicalis:

  • Single-Cell Transcriptomics/Proteomics:

    • Mapping PGAP2 expression at single-cell resolution across developmental stages

    • Identifying cell populations most affected by PGAP2 dysfunction

    • Tracing developmental trajectories altered by PGAP2 manipulation

  • Advanced Genome Editing:

    • Prime editing for precise introduction of human disease-causing mutations

    • Knock-in of fluorescent reporters to track PGAP2 localization in live embryos

    • Inducible degradation systems for temporal control of PGAP2 function

  • Spatial Transcriptomics/Proteomics:

    • Visualizing the spatial distribution of PGAP2 and its interacting partners

    • Mapping changes in GPI-anchored protein localization following PGAP2 manipulation

  • High-Content Phenotyping:

    • Automated imaging and machine learning for quantitative phenotyping

    • Behavioral analysis systems for assessing neurological phenotypes

  • Interactome Mapping:

    • Proximity labeling (BioID, APEX) to identify PGAP2 interaction partners in vivo

    • Comparative interactomics between wild-type and disease-variant PGAP2

These technologies could reveal previously unrecognized aspects of PGAP2 biology, from subcellular localization patterns to tissue-specific interaction networks and subtle phenotypic consequences of its dysfunction.

How might findings from Xenopus tropicalis PGAP2 research translate to human disease understanding?

Research on PGAP2 in Xenopus tropicalis offers several translational pathways to enhanced understanding of human disease:

  • Functional Validation of Variants:

    • Xenopus tropicalis provides an efficient system for testing the pathogenicity of human PGAP2 variants of uncertain significance

    • The diploid genome of X. tropicalis makes it particularly suitable for modeling human genetic disorders

  • Developmental Mechanisms:

    • Insights into how PGAP2 dysfunction affects neurogenesis, skeletal development, and other processes can illuminate pathogenic mechanisms in human hyperphosphatasia with mental retardation syndrome

    • Temporal windows of PGAP2 requirement may suggest optimal timing for therapeutic interventions

  • Pathway Discovery:

    • Identification of genes in the same "synphenotype group" as PGAP2 may reveal novel components of GPI anchor modification pathways relevant to human disease

    • Epistasis experiments can establish genetic hierarchies translatable to human biology

  • Therapeutic Screening:

    • Xenopus embryos are amenable to chemical screening approaches

    • Compounds that rescue PGAP2 knockdown phenotypes could represent candidate therapeutics for human PGAP2-related disorders

  • Biomarker Identification:

    • Molecular signatures of PGAP2 dysfunction could yield novel diagnostic or prognostic biomarkers beyond alkaline phosphatase levels

This translational approach leverages the experimental advantages of Xenopus tropicalis while maintaining focus on the clinical relevance of findings to human disease understanding and treatment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.