Recombinant Xenopus tropicalis Probable N-acetyltransferase camello (cml)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xenopus tropicalis Probable N-acetyltransferase camello (cml) is a protein expressed in E. coli and derived from Xenopus tropicalis, also known as the Western clawed frog or Silurana tropicalis . It functions as a probable N-acetyltransferase, with the Enzyme Commission number EC=2.3.1.- .

Key characteristics:

  • Product Code: CSB-CF717967XBF

  • UniProt No.: Q66KL0

  • Source: Produced in an in vitro E.coli expression system

  • Tag Info: Contains an N-terminal 10xHis-tag

  • Protein Length: Full length protein, corresponding to amino acids 1-219

  • Storage: It is recommended to store it at -20°C for extended storage, or conserve at -20°C or -80°C . Repeated freezing and thawing is not recommended; working aliquots can be stored at 4°C for up to one week .

  • Shelf Life: Liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C .

Function and Relevance

The protein is a probable N-acetyltransferase . N-acetyltransferases are enzymes that catalyze the transfer of acetyl groups from acetyl-CoA to various substrates, playing roles in numerous biological processes.

Xenopus tropicalis as a Model Organism

Xenopus tropicalis is a valuable model organism in biological research due to several key features:

  • Suitability for genetic studies X. tropicalis has a diploid genome with high conservation of gene synteny with the human genome, making it an attractive biomedical genetic model organism .

  • Similarities to mammalian immune systems The immune system of Xenopus demonstrates striking similarities to that of mammals, allowing for relevant immunological studies .

  • Versatility in disease modeling Xenopus is increasingly used for modeling human diseases, including the generation of solid tumor models and hematologic malignancies .

  • In vivo chemical screening Xenopus tadpoles can be used in in vivo chemical library screens to identify compounds affecting angiogenesis and lymphangiogenesis .

Applications in Research

Recombinant Xenopus tropicalis Probable N-acetyltransferase camello (cml) can be utilized in various research applications:

  • ** изучения ферментативной активности ** For studying its N-acetyltransferase activity and substrate specificity.

  • ** структурных исследований ** For structural studies to understand the protein's three-dimensional structure.

  • ** разработки антител ** As an antigen for antibody development.

  • ** лекарственных исследований ** As a target in drug discovery, particularly if the enzyme is implicated in disease pathways.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a particular tag, please inform us, and we will prioritize its development.
Synonyms
cml; Probable N-acetyltransferase camello
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-219
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
cml
Target Protein Sequence
MANVSIRKYKTSDYETARFLFAEGTKEHLPAACMYTLTTPRFYFITFVAFTSVFMGTGSY VLALTSLVALLAAGWYGLYSEFHGLASRFLRKDMLDIEKSYMMSENACFWVAEIDGKVVG TVGAQPSTDADDELLLQRISVARDYRQLRIGTKLCQTVIDFARQRGFNAVCLETANIQRA ATNLYERVGFKKSRVEILPSLVHQYTSFTVAYYRYNIKS
Uniprot No.

Target Background

Function
This protein plays a regulatory role in gastrulation. Specifically, it may function by modulating cell adhesion reduction in the periblastopore region, a crucial process for optimal cell motility.
Database Links
Protein Families
Camello family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is the functional classification of N-acetyltransferase camello (cml) in Xenopus tropicalis?

N-acetyltransferase camello (cml) belongs to the Camello family of proteins, which function as Histone Acetyltransferases (HATs) that specifically target histone H4. Initially classified as "probable N-acetyltransferases" based on sequence similarity, recent in vitro and in vivo analyses have confirmed that these proteins are active HATs . The protein (Uniprot: Q66KL0) consists of 219 amino acids and is evolutionarily conserved across chordates . Unlike other HAT families, Camello proteins are relatively smaller in size and lack other associated domains typically found in characterized HAT families .

  • How is the cml gene conserved across vertebrate species?

The cml gene shows significant evolutionary conservation across vertebrate species. Comparative genomic analyses reveal that Camello proteins are present in all chordates and first appeared in cnidarians in phylogeny . The table below shows homologous proteins identified in different species:

SpeciesGene SymbolProtein Accession
Xenopus tropicalis (tropical clawed frog)cmlNP_001008441.1
Xenopus tropicalis (tropical clawed frog)LOC100489847XP_002936328.2
Xenopus tropicalis (tropical clawed frog)LOC100489681XP_004921026.1
Xenopus tropicalis (tropical clawed frog)LOC101731427XP_004911367.1
Xenopus tropicalis (tropical clawed frog)LOC100145252NP_001120206.1
Xenopus tropicalis (tropical clawed frog)LOC100489520XP_004911368.1
Mus musculus (house mouse)Cml5NP_075982.2
Rattus norvegicus (Norway rat)Cml5NP_543160.1

This conservation pattern suggests functional importance across vertebrate evolution and makes Xenopus tropicalis an excellent model for studying cml function with potential translational relevance to higher vertebrates .

  • What expression patterns does cml show during Xenopus development?

While the provided search results don't contain specific data on cml expression patterns during Xenopus development, research approaches to determine this would include:

  • Whole-mount in situ hybridization (WISH) using cml-specific RNA probes to visualize spatial expression patterns across developmental stages

  • Quantitative RT-PCR to measure temporal expression changes during different Nieuwkoop and Faber developmental stages

  • RNA-seq analysis of different tissues and developmental timepoints

  • Reporter gene assays using the cml promoter region to drive fluorescent protein expression in transgenic embryos

Researchers should consider that developmental expression patterns may provide important clues to cml function, particularly in the context of its role as a histone acetyltransferase during embryonic development .

Intermediate Research Questions

  • What is the optimal methodology for working with recombinant Xenopus tropicalis cml protein in laboratory settings?

For optimal use of recombinant Xenopus tropicalis cml protein:

Storage and Handling:

  • Store at -20°C in Tris-based buffer with 50% glycerol

  • For extended storage, maintain at -80°C

  • Avoid repeated freeze-thaw cycles; working aliquots should be stored at 4°C for up to one week

Enzyme Activity Assays:

  • For HAT assays, use purified histone H4 as substrate (Camello proteins show specificity for H4)

  • Incorporate acetyl-CoA as the acetyl donor

  • Monitor acetylation using either:

    • Radioactive assays with [³H]-acetyl-CoA

    • Antibody-based detection using acetyl-lysine specific antibodies

    • Mass spectrometry for precise acetylation site mapping

Expression and Purification:

  • The full-length protein (amino acids 1-219) can be expressed with various tags determined during the production process

  • How can CRISPR/Cas9 technology be optimized for studying cml function in Xenopus tropicalis?

CRISPR/Cas9 genome editing in Xenopus tropicalis offers significant advantages for studying cml function:

Experimental Design:

  • Design sgRNAs targeting exonic regions of cml, preferably in early exons

  • Avoid targeting regions with potential off-target effects by thorough bioinformatic screening

  • For knockout studies, design sgRNAs that create frameshift mutations leading to premature stop codons

Microinjection Protocol:

  • Inject Cas9 protein (or mRNA) together with sgRNAs into one-cell stage embryos

  • F0 mosaic mutants (crispants) can be directly analyzed for phenotypes in early development

  • For germline transmission, raise F0 animals to adulthood and outcross to wild-type animals

Mutation Analysis:

  • Assess editing efficiency using TIDE (Tracking of Indels by DEcomposition) analysis, which can show >90% mutagenesis efficiency in X. tropicalis

  • For F0 mosaic mutants, analyze the distribution of indel types by amplicon sequencing

  • For phenotypic analysis, perform targeted deep sequencing to confirm clonal expansion of specific mutations

Advantages in Xenopus:

  • External fertilization and development allow easy manipulation and observation

  • Large numbers of synchronous embryos enable statistical power in analyses

  • Diploid genome of X. tropicalis simplifies genetic analysis compared to allotetraploid X. laevis

  • What approaches can be used to study the subcellular localization of cml protein in Xenopus cells?

Multiple complementary approaches can be employed to determine the subcellular localization of cml:

Immunofluorescence:

  • Use specific antibodies against cml if available

  • Alternatively, express epitope-tagged versions (FLAG, HA, etc.) and use tag-specific antibodies

  • Perform co-localization studies with established organelle markers

Fluorescent Protein Fusions:

  • Generate transgenic Xenopus expressing cml fused to fluorescent proteins (GFP, mCherry)

  • Create stable cell lines expressing fluorescently tagged cml

  • Perform live imaging to track dynamic localization

Biochemical Fractionation:

  • Prepare subcellular fractions (nuclear, cytoplasmic, membrane)

  • Analyze protein distribution by Western blotting

  • Perform enzymatic activity assays on isolated fractions

Important Considerations:

  • Based on research on Camello family proteins, expect potential perinuclear localization, as these were among the first identified HATs showing this localization pattern

  • Confirm that fusion proteins maintain enzymatic activity to ensure tagging doesn't disrupt protein function

  • Consider developmental stage-specific changes in localization

Advanced Research Questions

  • What role does cml play in epigenetic regulation during Xenopus development and how can this be comprehensively analyzed?

As a histone acetyltransferase specific for H4, cml likely plays an important role in epigenetic regulation during development. To comprehensively analyze this:

Multi-omics Approaches:

  • ChIP-seq using H4 acetylation-specific antibodies in wild-type vs. cml-depleted embryos

  • RNA-seq to identify genes with altered expression upon cml depletion

  • ATAC-seq to assess changes in chromatin accessibility

  • Integration of these datasets to identify direct vs. indirect effects

Developmental Stage Analysis:

  • Perform analyses across key developmental transitions

  • Focus on tissues with developmental defects observed in knockdown studies

  • Compare with expression patterns of other acetyltransferases

Rescue Experiments:

  • Perform domain-specific mutations to identify critical regions for enzymatic activity

  • Test for rescue with other HAT family members

  • Analyze whether human orthologs can functionally replace Xenopus cml

Candidate Developmental Pathways:

  • Based on Camello knockdown in zebrafish causing defects in axis elongation and head formation , focus on:

    • Wnt/β-catenin signaling (axis formation)

    • BMP and FGF signaling (dorsal-ventral patterning)

    • Neural induction and patterning pathways

  • How can transgenic Xenopus tropicalis models be developed to study the relationship between cml dysfunction and human disease?

Developing transgenic Xenopus models to study cml dysfunction requires sophisticated genetic approaches:

Transgenic Model Development:

  • Use I-SceI meganuclease-mediated transgenesis, which shows high efficiency (up to 30% in X. tropicalis)

  • For tissue-specific expression, utilize appropriate promoters (e.g., neural-specific, muscle-specific)

  • Generate both overexpression and dominant-negative forms of cml

CRISPR/Cas9 Knock-in Strategies:

  • Create precise mutations mirroring human disease-associated variants

  • Homology-directed repair (HDR) can be used for precise modifications

  • Establish stable F1 and F2 generations from founder animals

Disease Modeling Applications:

  • Generate reporter lines for real-time visualization of histone H4 acetylation changes

  • Create inducible systems to manipulate cml activity at specific developmental stages

  • Develop models for human diseases associated with histone acetylation dysregulation

Compound Screening:

  • Test small molecule HAT inhibitors or activators

  • Assess compound effects on developmental phenotypes

  • Utilize the ease of compound administration via water in Xenopus systems

  • What is the molecular mechanism of cml's histone acetyltransferase activity and how does it compare to other HAT families?

Understanding cml's molecular mechanism requires detailed biochemical and structural analyses:

Structural Characterization:

  • Perform X-ray crystallography or cryo-EM studies of cml alone and in complex with histone H4

  • Analyze the catalytic domain structure compared to classical HAT families

  • Identify acetyl-CoA binding sites and substrate recognition regions

Enzymatic Mechanism:

  • Characterize kinetic parameters (Km, kcat) for acetyl-CoA and histone substrates

  • Determine if cml has processive or distributive acetylation behavior on nucleosomal substrates

  • Identify specific lysine residues on H4 that are targeted by cml

Comparison with Other HATs:

  • Unlike classical HAT families (GNAT, MYST, p300/CBP), Camello proteins:

    • Are smaller in size

    • Lack characteristic domains found in known HAT families

    • Exhibit specificity towards histone H4

    • Display unique perinuclear localization

Regulatory Mechanisms:

  • Investigate post-translational modifications that regulate cml activity

  • Determine if cml functions independently or as part of larger complexes

  • Analyze potential interactions with other chromatin modifiers

  • What are the optimal strategies for performing loss-of-function studies of cml in Xenopus tropicalis embryos?

Multiple complementary strategies can be employed for loss-of-function studies:

CRISPR/Cas9 Knockout:

  • Create F0 mosaic mutants by injecting Cas9 and sgRNAs targeting cml

  • For complete gene disruption, target multiple sites simultaneously

  • Analyze phenotypes directly in F0 animals, which can show high penetrance (>90%)

  • For stable lines, breed F0 founders to wild-type animals

Morpholino Antisense Oligonucleides:

  • Design translation-blocking or splice-blocking morpholinos

  • Include appropriate controls to rule out off-target effects:

    • Standard control morpholinos

    • Rescue experiments with cml mRNA lacking the morpholino binding site

    • Use multiple morpholinos targeting different regions

  • Note that morpholinos can cause generic phenotypic effects, requiring careful validation

Dominant Negative Approaches:

  • Express catalytically inactive versions of cml that compete with endogenous protein

  • Create fusion proteins that recruit repressive complexes to cml targets

Inducible Systems:

  • Utilize heat-shock promoters or doxycycline-inducible systems for temporal control

  • Generate transgenic lines with Cre/loxP or GAL4/UAS systems for tissue-specific knockdown

Phenotypic Analysis:

  • Based on Camello knockdown in zebrafish, carefully assess axis formation and head development

  • Examine histone acetylation patterns using immunohistochemistry

  • Analyze changes in gene expression by in situ hybridization or RNA-seq

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.