Recombinant Xenopus tropicalis Probable polyprenol reductase (srd5a3)
Shipped with Ice Packs 
In Stock 
Product Specs
Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Note: While the tag type is determined during production, we prioritize fulfilling requests for specific tag types if provided.
Note: While the tag type is determined during production, we prioritize fulfilling requests for specific tag types if provided.
Synonyms
srd5a3; Polyprenol reductase; 3-oxo-5-alpha-steroid 4-dehydrogenase 3; Steroid 5-alpha-reductase 3; S5AR 3; SR type 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
srd5a3
Target Protein Sequence
MTLLALVWLLLDATFLITLLWHLLQGCKSGHSLLCSVFQDLIRYGKTKTGLQRPAWLQWF
DIPKRCFWHFYCVSLIWNGCLLWILLRLLLQSVPVPEWLQLVLHFLHAGSEPQILDRELS
VILALALLWLHSLRRLLECLFVSVFSNGVIHLVQYCFGLGYYFLIGITVLTYCPLDRRTV
STDNLLTQCHWYHILGLALYIWASLHQYRCHCILAGLRKSASGNVINLNHSVPCGDWFER
VSCPHYFAELLIYVSIAVVFGLLNTIWWLVVLYVLLNQALAALLCHEFYHEKFDTYPIHR
KAFIPFIF
Uniprot No.
Target Background
Function
This recombinant Xenopus tropicalis probable polyprenol reductase (SRD5A3) plays a crucial role in the early stages of protein N-linked glycosylation. It is essential for the conversion of polyprenol to dolichol, which is required for the synthesis of dolichol-linked monosaccharides and the oligosaccharide precursor used in N-glycosylation. It functions as a polyprenol reductase, catalyzing the NADP-dependent reduction of the α-isoprene unit of polyprenols to dolichols. Additionally, this enzyme exhibits the capability to convert testosterone (T) to 5α-dihydrotestosterone (DHT).
Database Links
Protein Families
Steroid 5-alpha reductase family, Polyprenol reductase subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
