Recombinant Xenopus tropicalis Protein C19orf12 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please inform us, and we will prioritize its development.
Synonyms
Protein C19orf12 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Protein Sequence
MPVQVDDIIKLLCHVSDHQKMKATIKHSARGALVAAAGAFLGGLVGGPPGIAVGGAVGGA MGAWMTSGQFKPIPQIIMELPPVQQQRLCDDIYTIVRTLDWTDATQLIMLVMGNDSLKQK VVAALINYMTKELQAEIQYGD
Uniprot No.

Target Background

Database Links

KEGG: xtr:448278

UniGene: Str.20908

Subcellular Location
Mitochondrion. Mitochondrion membrane; Single-pass membrane protein. Endoplasmic reticulum. Cytoplasm, cytosol.

Q&A

What is Xenopus tropicalis protein C19orf12 homolog and why is it important for research?

Xenopus tropicalis protein C19orf12 homolog is a protein encoded in the genome of the Western clawed frog (Xenopus tropicalis, also known as Silurana tropicalis). This protein is significant for research because it serves as a homolog to the human C19orf12 protein, which has been implicated in neurodegeneration with brain iron accumulation (NBIA) disorders. The full-length protein consists of 141 amino acids and is available as a recombinant protein with a His-tag, expressed in E. coli systems . Its importance lies in providing a model system for studying conserved functions that may be relevant to human disease mechanisms, particularly those involving lipid metabolism and neurodegeneration.

How conserved is the C19orf12 protein between Xenopus tropicalis and humans?

The C19orf12 protein shows significant conservation between species, making Xenopus tropicalis an appropriate model for studying its function. Xenopus tropicalis has a diploid genome with high conservation compared to humans, with considerable synteny that makes identification of orthologous genes straightforward . This conservation allows researchers to make meaningful inferences about the human protein's function by studying the Xenopus homolog. The Xenopus model is particularly valuable because its genome is more conserved with humans than some other model organisms, enabling more direct translational insights .

What are the key advantages of using Xenopus tropicalis as a model for studying C19orf12 function?

Xenopus tropicalis offers several distinct advantages for studying C19orf12 function:

  • Its diploid genome has high conservation and synteny with the human genome, facilitating accurate ortholog identification .

  • The Xenbase database provides readily accessible genomic information and tools for genetic analysis .

  • Maintenance costs are significantly lower than for rodent models .

  • A single mating pair can produce over 4,000 embryos in a day, enabling high-throughput experiments .

  • Rapid development allows for quick phenotypic assessment – within 4 days, embryos develop multiple organ systems .

  • CRISPR/Cas9 genome editing is well-established and cost-effective in this model .

  • The unique ability to create unilateral mutations (affecting only one half of the embryo) provides within-animal controls, which is exclusive to Xenopus models .

  • Parallel analysis of multiple genes is feasible, allowing researchers to identify common phenotypes relevant to disease mechanisms .

What biological pathways is the C19orf12 homolog involved in, and how can these be experimentally validated in Xenopus tropicalis?

Based on studies of C19orf12 homologs in other organisms, particularly the Drosophila homolog Nazo, the protein appears to be primarily involved in lipid homeostasis pathways. Research indicates that the protein plays critical roles in:

  • Triglyceride homeostasis

  • Lipid droplet maintenance, particularly in gut enterocytes

  • Potential roles at membrane contact sites, specifically at endoplasmic reticulum-lipid droplet contact sites

To experimentally validate these pathways in Xenopus tropicalis, researchers could employ several approaches:

  • CRISPR/Cas9-mediated loss-of-function studies followed by lipid profiling of tissues

  • Subcellular localization studies using fluorescently-tagged recombinant protein

  • Transcriptomic analysis of knockout embryos to identify differential expression of genes involved in lipid metabolism

  • Rescue experiments with wild-type protein to confirm phenotype specificity

  • In situ hybridization to determine tissue-specific expression patterns

The unilateral mutation approach unique to Xenopus provides an exceptional internal control for these experiments, as one side of the embryo can serve as a control for the mutated side .

How do mutations in the C19orf12 homolog affect triglyceride metabolism in model organisms, and what might this reveal about human disease mechanisms?

Studies in Drosophila have demonstrated that loss of Nazo, the C19orf12 homolog, results in a robust and fully penetrant lipid droplet depletion phenotype in gut tissue . This suggests a critical role for the protein in maintaining triglyceride homeostasis. The findings align with human data showing that C19orf12 is highly enriched in adipose tissue and other adipocyte-rich organs such as breast and liver .

In flies lacking Nazo, differential expression of multiple lipid metabolism genes is observed in gut tissue . This suggests that the protein may regulate transcription of genes involved in lipid metabolism or may function as part of a signaling pathway that modulates these processes.

These findings are particularly relevant to human disease mechanisms because mutations in human C19orf12 are associated with Mitochondrial membrane Protein-Associated Neurodegeneration (MPAN), a form of Neurodegeneration with Brain Iron Accumulation (NBIA) . Understanding how disrupted lipid metabolism contributes to neurodegeneration could provide novel insights into disease pathogenesis and potential therapeutic targets.

The Xenopus tropicalis model, with its genetic tractability and rapid development, offers an opportunity to further explore these connections between lipid metabolism and neurodegeneration in a vertebrate system that more closely approximates human biology than invertebrate models.

What are the optimal protocols for CRISPR/Cas9-mediated knockout of the C19orf12 homolog in Xenopus tropicalis?

For CRISPR/Cas9-mediated knockout of the C19orf12 homolog in Xenopus tropicalis, researchers should follow these methodological steps:

  • sgRNA Design: Target sequences in early exons to ensure functional disruption. Use Xenbase (https://www.xenbase.org) tools to identify appropriate target sites with minimal off-target effects .

  • CRISPR/Cas9 Delivery: Two primary approaches can be used:

    • Injection of Cas9 protein pre-complexed with sgRNA into fertilized eggs at the one-cell stage for complete organism knockout

    • Injection into one blastomere at the two-cell stage to create unilateral mutations, providing an internal control within each embryo

  • Verification of Mutagenesis:

    • T7 endonuclease assay or heteroduplex mobility assay to detect indels

    • Direct sequencing of PCR products from targeted regions

    • Cloning and sequencing of individual PCR products to characterize specific indels

  • Phenotypic Analysis:

    • For unilateral mutations, compare mutant and wild-type sides within the same embryo

    • Analyze lipid droplet formation using lipophilic dyes

    • Assess neural development and potential neurodegeneration phenotypes

    • Evaluate behavioral phenotypes starting at day 10 post-fertilization

  • Establishment of Stable Lines:

    • Raise F0 mosaic animals to adulthood

    • Outcross to wild-type animals to establish heterozygous F1 lines

    • Incross F1 heterozygotes to generate homozygous F2 animals for detailed phenotypic studies

This approach offers both rapid assessment in F0 embryos and the ability to establish stable lines for more detailed studies, combining speed with rigor .

What are the most effective methods for assessing lipid metabolism disruptions in Xenopus tropicalis C19orf12 homolog mutants?

Based on findings from other model organisms, particularly Drosophila studies of the Nazo (C19orf12 homolog) protein , several methods would be effective for assessing lipid metabolism disruptions in Xenopus tropicalis:

  • Lipid Droplet Visualization:

    • Oil Red O staining of fixed tissues

    • BODIPY or Nile Red staining for live imaging of lipid droplets

    • Transmission electron microscopy for ultrastructural analysis of lipid droplets and associated membranes

  • Biochemical Analyses:

    • Quantitative measurement of triglyceride content in tissues

    • Lipidomic profiling using mass spectrometry to identify specific lipid species affected

    • Analysis of fatty acid oxidation rates in isolated tissues

  • Gene Expression Analysis:

    • RNA-seq to identify differentially expressed lipid metabolism genes

    • qPCR validation of candidate genes involved in lipid synthesis, storage, and mobilization

    • In situ hybridization to assess spatial expression patterns of lipid metabolism genes

  • Functional Assays:

    • Feeding assays with labeled fatty acids to track uptake and metabolism

    • Starvation response studies to assess mobilization of lipid stores

    • Rescue experiments with dietary lipid supplementation

  • Imaging Studies:

    • Confocal microscopy of fluorescently-tagged proteins to assess subcellular localization

    • Live imaging of lipid droplet dynamics in developing embryos

    • Analysis of membrane contact sites between endoplasmic reticulum and lipid droplets

These approaches would provide comprehensive data on how C19orf12 homolog disruption affects lipid metabolism, potentially revealing conserved mechanisms relevant to human disease states.

How do the phenotypes of C19orf12 homolog disruption compare across different model organisms (Xenopus, Drosophila, and others)?

Comparative analysis of C19orf12 homolog disruption across different model organisms reveals both shared and divergent phenotypes that provide insight into the protein's conserved functions:

Xenopus tropicalis:

  • While specific phenotypes of C19orf12 homolog disruption are not detailed in the provided search results, the established CRISPR protocols would allow for direct investigation

  • Based on the conservation between species, lipid homeostasis disruptions would be anticipated

  • The diploid nature of X. tropicalis allows for direct comparison with human genetics

Human (C19orf12 mutations):

  • Associated with Mitochondrial membrane Protein-Associated Neurodegeneration (MPAN)

  • Characterized by iron accumulation in the substantia nigra and globus pallidum

  • Frontotemporal atrophy observed in brain MRI

  • Clinical presentation can include depression and neurological symptoms

The comparison across species suggests a conserved role in lipid metabolism that, when disrupted, leads to tissue-specific effects. In Drosophila, the most prominent effects are in gut enterocytes, while in humans, the neurological system appears particularly vulnerable. This cross-species comparison highlights the value of studying this protein in multiple models to understand tissue-specific functions and their relevance to human disease.

What insights can be gained by comparing the protein structure and interactome of C19orf12 homologs across different species?

Comparative analysis of C19orf12 protein structure and interactome across species can provide valuable insights into conserved functional domains and interaction networks:

Protein Structure Comparison:

  • The Xenopus tropicalis C19orf12 homolog consists of 141 amino acids , which can be compared to the human protein to identify conserved domains

  • Structural analysis could reveal conserved transmembrane domains, which would support the proposed role in membrane contact sites

  • Identification of conserved post-translational modification sites would suggest regulatory mechanisms maintained throughout evolution

  • Regions with highest conservation likely represent functional domains critical for protein activity

Interactome Analysis:

  • Comparing protein interaction networks across species could identify core conserved interactions versus species-specific partners

  • Conservation of interactions with proteins involved in lipid metabolism would reinforce the role in lipid homeostasis

  • Novel interaction partners identified in Xenopus could guide investigation of previously unrecognized functions in humans

  • Differential interactome mapping under various metabolic conditions could reveal context-specific functions

Methodological Approaches:

  • Yeast two-hybrid screening using the Xenopus homolog as bait

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling approaches such as BioID or APEX in Xenopus cells

  • Comparative bioinformatic analysis of predicted interaction networks

Understanding these structural and interactome details across species would help pinpoint the most critical aspects of C19orf12 function and guide targeted therapeutic approaches for related human disorders.

How can Xenopus tropicalis be utilized to model human diseases associated with C19orf12 mutations, particularly Neurodegeneration with Brain Iron Accumulation (NBIA)?

Xenopus tropicalis provides an excellent platform for modeling human diseases associated with C19orf12 mutations, particularly NBIA/MPAN, through several approaches:

  • CRISPR/Cas9 Genome Editing:

    • Introduction of specific human disease-causing mutations into the Xenopus C19orf12 homolog using homology-directed repair

    • Complete knockout to assess loss-of-function phenotypes

    • Creation of compound heterozygotes to mimic patient genotypes

  • Phenotypic Assessment:

    • Evaluation of iron accumulation in brain tissues using Perl's Prussian blue staining

    • Assessment of neurodegeneration using histological and immunohistochemical approaches

    • Behavioral assays starting at day 10 post-fertilization to detect motor or cognitive deficits

    • Analysis of lipid metabolism in neural tissues to connect metabolic dysfunction to neurodegeneration

  • Advantages of Xenopus for NBIA Modeling:

    • Rapid development allows assessment of early phenotypes

    • The transparency of tadpoles facilitates in vivo imaging

    • High-throughput screening of potential therapeutic compounds is feasible

    • The unilateral mutation approach provides internal controls

    • Conservation of brain development pathways between Xenopus and humans

  • Comparative Disease Modeling:

    • Parallel analysis of multiple NBIA-associated genes to identify common pathways

    • Creation of complex disease models incorporating environmental factors

    • Cross-species validation of findings between Xenopus, Drosophila, and mammalian models

This approach exemplifies how Xenopus tropicalis can be utilized to create cost-effective, high-throughput disease models that complement other systems while offering unique advantages for certain types of analyses .

What experimental approaches can distinguish between lipid metabolism defects and neurodegeneration phenotypes in C19orf12 mutant Xenopus models?

Distinguishing between primary lipid metabolism defects and secondary neurodegeneration phenotypes in C19orf12 mutant Xenopus models requires careful experimental design:

  • Temporal Analysis:

    • Conduct time-course studies to determine which phenotypes appear first

    • Track changes in lipid metabolism markers prior to onset of neurodegeneration

    • Utilize inducible gene disruption systems to determine temporal requirements for C19orf12 function

  • Tissue-Specific Manipulations:

    • Target CRISPR/Cas9 to specific tissues by injecting into particular blastomeres based on the Xenopus fate map

    • Use tissue-specific promoters to drive rescue constructs in either neural tissues or metabolic tissues

    • Compare phenotypes from broadly expressed versus tissue-restricted manipulations

  • Mechanistic Studies:

    • Perform lipidomic analysis on isolated neural tissues before and after onset of degeneration

    • Assess mitochondrial function in neural tissues to determine if defects precede degeneration

    • Examine membrane contact sites and lipid trafficking between organelles in affected neurons

  • Rescue Experiments:

    • Test whether supplementation with specific lipids can rescue neurodegeneration phenotypes

    • Attempt to rescue with human C19orf12 or specifically mutated versions to identify functional domains

    • Evaluate whether correcting lipid metabolism through alternative pathways can prevent neural phenotypes

  • Biochemical Separation:

    • Isolate distinct C19orf12 protein complexes from different tissues

    • Determine if the protein has tissue-specific interactors or post-translational modifications

    • Identify tissue-specific functions through proteomics approaches

These approaches would help determine whether neurodegeneration is a direct consequence of C19orf12 dysfunction in neural tissues or secondary to systemic metabolic disturbances, providing insight into disease mechanisms and potential therapeutic targets.

What are the common challenges in working with recombinant Xenopus tropicalis C19orf12 homolog protein and how can they be addressed?

Working with recombinant Xenopus tropicalis C19orf12 homolog presents several technical challenges that researchers should anticipate:

  • Protein Solubility Issues:

    • Challenge: The protein may form inclusion bodies when expressed in E. coli

    • Solution: Optimize expression conditions by lowering induction temperature (16-20°C), reducing IPTG concentration, or using specialized E. coli strains

    • Alternative: Consider fusion tags beyond His-tag , such as GST or MBP, which can enhance solubility

    • Validation: Perform solubility tests with different buffer conditions to identify optimal purification parameters

  • Functional Activity Assessment:

    • Challenge: Determining if the recombinant protein retains native functionality

    • Solution: Develop in vitro assays based on predicted functions in lipid metabolism

    • Alternative: Compare activities of wild-type protein with disease-associated mutant versions

    • Validation: Use rescue experiments in CRISPR knockout models to confirm biological activity

  • Protein Stability:

    • Challenge: Maintaining protein stability during purification and storage

    • Solution: Include appropriate protease inhibitors and optimize buffer conditions

    • Alternative: Consider adding stabilizing agents such as glycerol or specific lipids

    • Validation: Perform time-course stability assays to determine optimal storage conditions

  • Membrane Association:

    • Challenge: If C19orf12 associates with membranes or membrane contact sites , this may complicate purification

    • Solution: Use detergents compatible with maintaining protein function when extracting

    • Alternative: Consider preparing microsomal fractions that retain native membrane environment

    • Validation: Compare protein activity in detergent-solubilized versus membrane-associated forms

  • Post-translational Modifications:

    • Challenge: E. coli may not provide necessary post-translational modifications

    • Solution: Consider eukaryotic expression systems for specific applications

    • Alternative: Identify critical modifications through mass spectrometry of native protein

    • Validation: Compare function of protein expressed in different systems

These technical considerations are crucial for ensuring that experiments with the recombinant protein yield reliable and physiologically relevant results.

How can researchers optimize CRISPR/Cas9 efficiency for targeting the C19orf12 homolog in Xenopus tropicalis?

Optimizing CRISPR/Cas9 efficiency for targeting the C19orf12 homolog in Xenopus tropicalis requires attention to several key factors:

  • sgRNA Design Optimization:

    • Select target sites with GC content between 40-60% for optimal efficiency

    • Avoid regions with predicted secondary structures that might interfere with sgRNA function

    • Use Xenopus-specific CRISPR design tools available through Xenbase to account for species-specific genomic features

    • Design multiple sgRNAs targeting different exons to increase the likelihood of successful gene disruption

  • Delivery Method Refinement:

    • Optimize injection volume (typically 2-5 nl) and concentration of Cas9-sgRNA ribonucleoprotein complex

    • Consider the timing of injection (ideally at one-cell stage for full knockout or two-cell stage for unilateral knockout)

    • Use fine-tipped glass needles and precision microinjectors to minimize embryo damage

    • Include a fluorescent tracer to confirm successful injection

  • Validation Strategy:

    • Employ T7 endonuclease assay to quickly assess editing efficiency

    • Use TIDE (Tracking of Indels by Decomposition) analysis for quantitative assessment of editing outcomes

    • Sequence PCR products from targeted regions to characterize specific mutations

    • Design genotyping strategies for identifying founders for establishing lines

  • Minimizing Off-target Effects:

    • Perform whole-genome sequencing on a subset of mutants to identify potential off-target sites

    • Use Cas9 variants with enhanced specificity when available

    • Validate phenotypes with multiple independent sgRNAs targeting different regions of the gene

    • Perform rescue experiments with wild-type protein to confirm specificity of observed phenotypes

  • Enhancing Homology-Directed Repair (HDR) for Precise Mutations:

    • For introducing specific mutations rather than knockouts, optimize donor template design

    • Consider chemical treatments that enhance HDR efficiency

    • Use asymmetric donor templates with longer homology arms on one side

    • Employ Cas9 nickase for HDR-mediated editing to reduce off-target effects

These optimization strategies will help researchers achieve efficient and specific genetic manipulation of the C19orf12 homolog in Xenopus tropicalis, facilitating detailed functional studies and disease modeling .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.