Recombinant Xenopus tropicalis Protein FAM210A (fam210a)

What is FAM210A and what is its biological significance?

FAM210A is a novel mitochondrial protein that plays a vital role in regulating mitochondrial function and homeostasis. It has been identified as a hub gene in mouse cardiac remodeling through multi-omics studies . FAM210A functions as a mitochondrial translation regulator, interacting with the mitochondrial translation elongation factor EF-Tu in a protein complex involved in the regulation of mitochondrial-encoded mRNA translation . This protein is highly conserved across species, indicating its fundamental biological importance.

The biological significance of FAM210A lies in its role in maintaining mitochondrial homeostasis and normal cellular function, particularly in tissues with high energy demands such as cardiac muscle. Disruption of FAM210A expression has been linked to several pathological conditions, including sarcopenia and heart failure .

How is FAM210A structurally characterized in Xenopus tropicalis?

The Xenopus tropicalis FAM210A protein consists of 274 amino acids with the following sequence:
MHLLRTLLLRSNTSNISLLTKCAFRACPLQKWPVSLRSGCQVSVLPTQQKKWLHSQPKQQDSSTKTPVHDLPSGSQHQSEESSPSAKSSISTDTSIVAETDPLQDQSIGLLKRFKKTFKQHGKVLIPVHLVTSSFWFGSFYYAAMKGVNVVPFLEFIGLPDVIVNILKNSQGGNALTAYAMYKIATPARYTVTLGGTSLSVKYLRKYGYLSTPPLVKDYFQDRMEETKELFTEKMEETRDIIS
GKMEETKDRISEKLQETKDRVAFRKKKNEEM

The protein contains specific domains that facilitate its mitochondrial localization and function in translation regulation. When produced as a recombinant protein, it is often tagged with an N-terminal 10xHis-tag to facilitate purification and detection in experimental settings .

What expression patterns does FAM210A show across different tissues?

FAM210A shows tissue-specific expression patterns, with particularly high expression in metabolically active tissues. In the heart, FAM210A is highly expressed in cardiomyocytes (CMs) compared to cardiac fibroblasts (CFs) . Single-cell RNA-seq data reveals that the highest expression of FAM210A is found in cardiomyocytes compared to any other human cell type . This expression pattern aligns with its functional role in maintaining mitochondrial homeostasis in cells with high energy demands.

The differential expression of FAM210A across tissues suggests tissue-specific functions and regulatory mechanisms, which may be important considerations when designing experiments using recombinant FAM210A protein.

What are the optimal conditions for storing and handling recombinant Xenopus tropicalis FAM210A protein?

For optimal storage and handling of recombinant Xenopus tropicalis FAM210A protein:

• Store the protein at -20°C for regular use, or at -80°C for extended storage .

• The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for protein stability .

• Avoid repeated freeze-thaw cycles as this can lead to protein degradation and loss of activity .

• For working stocks, prepare aliquots and store at 4°C for up to one week .

• If provided in lyophilized form, reconstitute in the appropriate buffer according to the manufacturer's instructions (typically a Tris/PBS-based buffer, pH 8.0, with 6% trehalose) .

These storage conditions are critical for maintaining protein integrity and activity for experimental applications, particularly for functional assays investigating mitochondrial translation.

How can recombinant FAM210A be used to study mitochondrial translation mechanisms?

To study mitochondrial translation mechanisms using recombinant FAM210A:

• In vitro translation assays: Recombinant FAM210A can be added to mitochondrial translation systems to assess its direct effect on translation efficiency. This can be measured by monitoring the incorporation of radiolabeled amino acids into nascent peptides.

• Mitochondrial polysome profiling: As demonstrated in research, mitochondrial polysome profiling analysis can reveal how FAM210A affects the association of mRNAs with ribosomes . This technique involves isolating mitochondria, extracting polysomes, and analyzing the distribution of mRNAs across polysome fractions in the presence or absence of recombinant FAM210A.

• Protein-protein interaction studies: Use recombinant FAM210A in pull-down assays or co-immunoprecipitation experiments to identify its interaction partners within the mitochondrial translation machinery, particularly its known interaction with the elongation factor EF-Tu .

• Reconstitution experiments: In systems where endogenous FAM210A has been depleted (e.g., using siRNA or CRISPR-Cas9), recombinant protein can be introduced to assess rescue of translation defects, providing insights into structure-function relationships.

These methodological approaches can provide valuable insights into how FAM210A regulates mitochondrial translation at the molecular level.

What experimental controls should be included when working with recombinant FAM210A protein?

When designing experiments with recombinant Xenopus tropicalis FAM210A protein, the following controls should be included:

• Buffer-only control: Include the storage buffer without the recombinant protein to control for any effects of buffer components.

• Inactive protein control: If available, use a mutated version of FAM210A that lacks functionality but retains structural integrity to distinguish between specific and non-specific effects.

• Species-specific controls: When studying FAM210A across different species, include appropriate species-matched controls to account for potential species-specific differences in protein function.

• Dose-response experiments: Test multiple concentrations of recombinant FAM210A to establish dose-dependent effects and determine optimal working concentrations.

• Time-course analysis: Perform time-course experiments to capture dynamic processes and determine the optimal timepoints for observing FAM210A effects.

These controls help ensure experimental rigor and facilitate the interpretation of results when investigating FAM210A's role in mitochondrial function.

How can researchers study the interaction between FAM210A and the mitochondrial translation machinery?

To investigate FAM210A's interaction with the mitochondrial translation machinery:

• Structural biology approaches: Use techniques such as X-ray crystallography or cryo-electron microscopy to determine the three-dimensional structure of FAM210A in complex with components of the mitochondrial translation machinery, particularly EF-Tu .

• Site-directed mutagenesis: Generate mutant versions of recombinant FAM210A to identify residues critical for interaction with translation factors or ribosomes, and assess their impact on translation efficiency.

• Cross-linking mass spectrometry: Apply chemical cross-linking followed by mass spectrometry to map the interaction interfaces between FAM210A and its binding partners within the translation machinery.

• Proximity labeling: Use techniques like BioID or APEX to identify proteins in close proximity to FAM210A within the mitochondrial matrix during active translation.

• Single-molecule imaging: Apply fluorescently labeled recombinant FAM210A in single-molecule imaging experiments to visualize its dynamics and interactions with the translation machinery in real-time.

These advanced approaches can provide detailed insights into how FAM210A interacts with and regulates the mitochondrial translation machinery at the molecular level.

What are the key considerations when designing experiments to compare FAM210A function across different species?

When comparing FAM210A function across species, researchers should consider:

• Sequence conservation analysis: Perform detailed sequence alignments to identify conserved domains and species-specific variations that might affect function. Xenopus tropicalis FAM210A shares significant homology with mammalian orthologs, but may have species-specific features .

• Expression system compatibility: Ensure that the heterologous expression system used to produce recombinant proteins (typically E. coli for Xenopus tropicalis FAM210A) properly folds the protein and incorporates any necessary post-translational modifications .

• Functional assay selection: Choose assays that can be standardized across species, controlling for differences in optimal reaction conditions (temperature, pH, ionic strength) that might affect protein activity independently of intrinsic functional differences.

• Cellular context considerations: Account for differences in mitochondrial biology between species when interpreting results, particularly when extrapolating findings from Xenopus to mammalian systems.

• Evolutionary perspective: Interpret functional differences in the context of evolutionary adaptations and species-specific physiological demands.

These considerations help ensure that observed differences in FAM210A function across species reflect genuine biological variation rather than experimental artifacts.

How can recombinant FAM210A be used to investigate its role in cardiac pathologies?

Recombinant FAM210A can be used to investigate its role in cardiac pathologies through:

• Ex vivo rescue experiments: In isolated cardiomyocytes from FAM210A-deficient models, recombinant protein can be introduced to assess rescue of mitochondrial dysfunction, providing insights into therapeutic potential .

• Protein-protein interaction networks: Use recombinant FAM210A to identify cardiac-specific interaction partners that might mediate its protective effects against ischemic damage, as suggested by decreased FAM210A expression in human ischemic heart failure samples .

• Post-translational modification analysis: Study how cardiac-specific post-translational modifications of FAM210A affect its function, potentially explaining tissue-specific roles.

• Integrated stress response (ISR) modulation: Investigate how recombinant FAM210A affects the ISR pathway in cardiac cells, as multi-omics analyses indicate that FAM210A deficiency persistently activates ISR, leading to pathogenic progression of heart failure .

• Therapeutic development platform: Use structure-function studies with recombinant FAM210A to develop peptide mimetics or small molecules that could enhance endogenous FAM210A activity in compromised cardiac tissue.

These applications leverage recombinant FAM210A as both an investigative tool and potential therapeutic modality for cardiac pathologies.

How should researchers address potential artifacts when using recombinant versus native FAM210A in functional assays?

When comparing recombinant and native FAM210A:

• Tag interference assessment: Evaluate whether the presence of purification tags (e.g., His-tag) on recombinant FAM210A affects its function by comparing tagged and untagged versions or using tag-removal approaches .

• Post-translational modification analysis: Characterize post-translational modifications present on native FAM210A but potentially absent in recombinant protein produced in bacterial systems, and assess their functional significance.

• Protein folding verification: Use circular dichroism or limited proteolysis to compare the structural integrity of recombinant versus native FAM210A, ensuring proper folding of the recombinant protein.

• Functional benchmarking: Compare the activity of recombinant and native FAM210A in standardized assays to establish equivalence or determine correction factors for quantitative analyses.

• Context-dependent activity: Consider that recombinant FAM210A may behave differently in isolation compared to the native protein in its normal mitochondrial environment, and design experiments that account for these contextual factors.

These approaches help differentiate true biological insights from artifacts introduced by the use of recombinant proteins in experimental systems.

What are the challenges in interpreting multi-omics data related to FAM210A function?

Interpreting multi-omics data for FAM210A function presents several challenges:

• Integration of diverse data types: Research has used transcriptomic, translatomic, proteomic, and metabolomic approaches to study FAM210A function . Integrating these different data types requires sophisticated computational approaches to identify consistent patterns across platforms.

• Primary versus secondary effects: Distinguishing direct effects of FAM210A on mitochondrial translation from secondary consequences of mitochondrial dysfunction requires careful experimental design and time-course analyses.

• Cell type specificity: FAM210A shows cell type-specific expression patterns, particularly high in cardiomyocytes , meaning that bulk tissue analyses may dilute cell type-specific signals, requiring single-cell approaches for accurate interpretation.

• Temporal dynamics: The progressive nature of pathologies associated with FAM210A deficiency (e.g., dilated cardiomyopathy) means that omics snapshots at different timepoints may reveal different aspects of the pathway, necessitating longitudinal studies.

• Cross-species translation: Translating findings from animal models (e.g., mouse KO models) to human pathologies requires careful consideration of species-specific differences in FAM210A function and regulation.

Addressing these challenges requires integrated experimental and computational approaches that account for the complex role of FAM210A in mitochondrial homeostasis.

What novel approaches could advance our understanding of FAM210A's role in mitochondrial translation?

Future research on FAM210A could benefit from:

• Cryo-EM structural studies: Determine the high-resolution structure of FAM210A in complex with mitochondrial ribosomes and translation factors to understand its precise molecular mechanism.

• In situ proximity labeling: Apply techniques like APEX2 fused to FAM210A to identify its binding partners in the native mitochondrial environment under different physiological and pathological conditions.

• Single-molecule translation assays: Develop reconstituted mitochondrial translation systems that allow real-time visualization of FAM210A's impact on translation kinetics at the single-molecule level.

• CRISPR-based screens: Conduct genetic screens to identify synthetic lethal or rescue interactions with FAM210A deficiency, revealing new components of its functional network.

• Tissue-specific conditional knockout models: Generate and characterize tissue-specific FAM210A knockout models beyond cardiac tissue to understand its role in different physiological contexts, building on existing cardiac-specific models .

These approaches would provide deeper insights into FAM210A's molecular mechanism and physiological significance across different tissues and disease states.

How might therapeutic strategies targeting FAM210A be developed for cardiac diseases?

Based on current research, potential therapeutic strategies targeting FAM210A include:

• AAV-mediated gene therapy: Building on the finding that AAV9-mediated overexpression of FAM210A promotes mitochondrial-encoded protein expression and improves cardiac function in ischemia-induced heart failure models .

• Small molecule stabilizers: Develop compounds that stabilize FAM210A protein or enhance its activity in mitochondrial translation, potentially preventing its downregulation in heart failure.

• miRNA inhibitors: Target the miR-574-FAM210A axis, which plays a role in regulating mitochondrial proteomic homeostasis and cardiac remodeling , using anti-miR strategies to increase FAM210A expression.

• Peptide mimetics: Design peptides that mimic the functional domains of FAM210A that interact with the translation machinery, potentially substituting for decreased endogenous protein.

• Integrated stress response modulation: Target the persistent activation of integrated stress response observed in FAM210A deficiency , using existing ISR modulators as adjunct therapy.

These therapeutic approaches could potentially address the mitochondrial dysfunction underlying various cardiomyopathies and heart failure conditions associated with FAM210A deficiency.