Recombinant Xenopus tropicalis Protein odr-4 homolog (odr4)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us for preferential development.
Synonyms
odr4; Protein odr-4 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-448
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
odr4
Target Protein Sequence
MGRSYYVDDGVEKYFSKLIQQQKAYVTGLLIGQYSSQRDYAVLAAQTPQKEDQSEETKSG FSKLEGIDDEWVSMHASQLGRMLPGGLMVLGVFLMTSPDLSKDAQNVLRKLVFTVEKSSM KNRLWNFDDDDVSERVTLHICSATKKITCRTYDINDPKSTPKPADWKYQSSGLSWLTIDC SVRVDVTIPLTSSSLTYQERQKSIRLGLVKWAKEIEDSLVLFNGQVKDKSADLFEEQKKS SRSSSHYSPQIITANVLTAAPLIDSTRSTALVQPCKSSLTIQGVVKCCGYIHSNRPKVKD ALQAVKRDILNTIQARCEMLFEDMMLNGPSKGTENEVCPLPQRVFVPIKGSSLKLCDYLF GDETSSDLQSHFLEIMDQEVEQNELEFPEKKCSCTQPEERESEPVSYNLESKPVDQANSS SKFLLNKGLLISTVVASIAVIISFYYII
Uniprot No.

Target Background

Function

May play a role in the trafficking of a subset of G-protein coupled receptors.

Database Links
Protein Families
ODR-4 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the Xenopus tropicalis Protein odr-4 homolog (odr4)?

Protein odr-4 homolog (odr4) is a full-length protein consisting of 448 amino acids derived from Xenopus tropicalis, commonly known as the Western clawed frog or Silurana tropicalis. The protein is characterized by its UniProt identification number Q0VA36 and possesses a specific amino acid sequence beginning with MGRSYYVDDGVEKYFSKLIQQQK. This protein is part of the odr-4 family, which is involved in various cellular functions, particularly related to membrane localization and protein trafficking processes. The protein contains several conserved domains that contribute to its structural integrity and functional role in amphibian cellular biology .

How is Recombinant Xenopus tropicalis Protein odr-4 homolog typically expressed and purified?

The recombinant form of Xenopus tropicalis Protein odr-4 homolog is predominantly expressed using Escherichia coli (E. coli) expression systems. This bacterial expression platform allows for efficient production of the protein with various fusion tags, commonly including an N-terminal His-tag for purification purposes. The expression typically covers the full-length protein sequence (amino acids 1-448), ensuring complete structural and functional properties. Following expression, the protein undergoes purification protocols, often resulting in preparations with greater than 90% purity as determined by SDS-PAGE analysis. The purified protein is then formulated in a Tris-based buffer containing 50% glycerol or alternatively in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What are the optimal storage conditions for maintaining Recombinant Xenopus tropicalis Protein odr-4 homolog activity?

To maintain optimal activity and structural integrity of Recombinant Xenopus tropicalis Protein odr-4 homolog (odr4), researchers should adhere to specific storage protocols. The protein should be stored at -20°C for routine use, while extended storage periods require conservation at -20°C or -80°C. When working with the protein, it is advisable to avoid repeated freeze-thaw cycles, as these can lead to protein denaturation and activity loss. For short-term experimental work, temporary storage of working aliquots at 4°C for up to one week is acceptable. When the protein is provided in lyophilized form, reconstitution should be performed in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and the addition of 5-50% glycerol (final concentration) is recommended for subsequent long-term storage .

How does the structure of Xenopus tropicalis odr-4 homolog compare with its orthologs in other species?

Comparative structural analysis between Xenopus tropicalis odr-4 homolog and its counterpart in Xenopus laevis reveals high sequence homology with specific distinctions. The Xenopus laevis odr-4 homolog (UniProt ID: A3KNB6) consists of 446 amino acids compared to the 448 amino acids in X. tropicalis. Sequence alignment shows approximately 90% identity between these orthologs, with notable variations in amino acid residues that may influence protein-protein interactions and functional specificity. Key differences include substitutions in the N-terminal region where X. tropicalis has GVEKYFSKLIQQQKAYVTG while X. laevis has RVEKYFSKLVQQQKACITG. These alterations potentially affect binding affinities and interaction dynamics with partner proteins. Both proteins contain conserved transmembrane domains and signal sequences, suggesting preservation of core functional elements across these closely related amphibian species .

What experimental approaches are most effective for studying protein-protein interactions involving odr-4 homolog?

When investigating protein-protein interactions involving Xenopus tropicalis odr-4 homolog, multiple complementary experimental approaches yield comprehensive insights. Co-immunoprecipitation (Co-IP) using anti-His antibodies against the recombinant His-tagged odr-4 homolog serves as a foundational technique for identifying binding partners in native or experimental systems. This approach can be enhanced through crosslinking methodologies to capture transient interactions. For higher-resolution analysis, proximity labeling techniques such as BioID or APEX2 fusion constructs allow identification of proximal proteins in cellular contexts. Yeast two-hybrid screening provides an alternative system for detecting direct interactions, while fluorescence resonance energy transfer (FRET) enables visualization of interactions in living cells. Additionally, surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) offer quantitative measurements of binding kinetics and thermodynamics when studying purified interaction partners. The integration of these methodologies creates a robust workflow for characterizing the odr-4 homolog interactome in research settings .

What are the challenges in expressing functional Xenopus tropicalis odr-4 homolog in heterologous systems?

Expression of functional Xenopus tropicalis odr-4 homolog in heterologous systems presents several significant challenges that researchers must address through methodological optimization. First, codon usage bias between amphibian and bacterial or mammalian expression systems can lead to translational pausing and protein misfolding; this necessitates codon optimization of the odr4 gene sequence for the target expression system. Second, the presence of hydrophobic regions in the protein sequence, particularly at the C-terminal domain (GLLISTVVASIAVIISFYYII), often results in aggregation during expression, requiring the addition of solubilizing fusion tags such as SUMO or MBP, or the use of specialized E. coli strains like Rosetta-gami or SHuffle. Third, post-translational modifications present in the native amphibian system may be absent in prokaryotic systems, potentially affecting protein folding and function; this may necessitate expression in eukaryotic systems such as insect cells or mammalian cell lines. Finally, protein purification often requires optimization of detergent conditions for membrane-associated regions while maintaining protein stability and activity. Addressing these challenges requires iterative optimization of expression conditions, including temperature reduction to 16-18°C during induction, and careful selection of purification strategies .

How can researchers effectively analyze the membrane association properties of odr-4 homolog?

Analysis of membrane association properties of odr-4 homolog requires a multi-faceted approach combining biochemical fractionation with advanced imaging techniques. Initially, subcellular fractionation followed by Western blot analysis provides basic localization information, distinguishing between cytosolic, membrane, and nuclear fractions. For more detailed characterization, sucrose density gradient ultracentrifugation enables separation of different membrane compartments based on their buoyant densities. To determine the nature of membrane association, researchers should perform membrane extraction assays using various reagents: high-salt buffers (1-2M NaCl) extract peripherally associated proteins, while detergents (1% Triton X-100 or 0.1% SDS) are required for integral membrane proteins. The hydrophobic C-terminal region of odr-4 homolog (GLLISTVVASIAVIISFYYII) suggests potential transmembrane domain characteristics, which can be confirmed using protease protection assays to determine topology. For visualization, confocal microscopy with fluorescently tagged protein variants provides spatial distribution information, while super-resolution techniques like STORM or STED microscopy offer nanoscale resolution of membrane localization patterns. Complementary biophysical approaches such as circular dichroism spectroscopy in the presence of membrane mimetics can further characterize structural changes associated with membrane interaction .

What is the recommended protocol for reconstituting lyophilized Recombinant Xenopus tropicalis Protein odr-4 homolog?

The optimal reconstitution protocol for lyophilized Recombinant Xenopus tropicalis Protein odr-4 homolog involves several critical steps to ensure maximum protein recovery and activity. Begin by briefly centrifuging the vial containing lyophilized protein (3-5 minutes at 10,000 × g) to bring all content to the bottom of the tube, minimizing product loss during opening. Reconstitution should be performed using deionized sterile water to achieve a protein concentration between 0.1-1.0 mg/mL, with gentle mixing by slow rotation or inversion rather than vortexing to prevent protein denaturation. Following initial resuspension, the addition of glycerol to a final concentration of 5-50% (with 50% being optimal for long-term storage) helps maintain protein stability during freeze-thaw cycles. For experiments requiring alternative buffers, consider dialyzing the reconstituted protein against Tris-based experimental buffers with pH 7.5-8.0. Following reconstitution, the solution should be aliquoted into small volumes (20-50 μL) to minimize freeze-thaw cycles during experimental use. Quality control should include verification of protein concentration using standard methods such as Bradford assay or BCA, and confirmation of integrity via SDS-PAGE analysis .

How can researchers validate the functionality of expressed Recombinant Xenopus tropicalis Protein odr-4 homolog?

Validating functionality of expressed Recombinant Xenopus tropicalis Protein odr-4 homolog requires a multi-parameter assessment approach centered on structure-function relationships. Primary structural validation involves SDS-PAGE and Western blot analysis using anti-His antibodies (for His-tagged variants) or specific anti-odr-4 antibodies to confirm protein identity and molecular weight (~50 kDa). Secondary structure assessment through circular dichroism spectroscopy should reveal characteristic α-helical patterns, particularly important for the predicted transmembrane regions. Functional validation should focus on known protein activities, including:

  • Protein-protein interaction assays with known binding partners

  • Subcellular localization studies using fractionation techniques and immunofluorescence microscopy

  • Lipid binding assays to confirm membrane association properties

  • Functional complementation studies in model systems

Activity assessment may include monitoring the protein's ability to facilitate membrane trafficking or localization of associated proteins. For quantitative functional analysis, researchers can employ surface plasmon resonance (SPR) to measure binding kinetics with interacting proteins or lipid membranes. Thermal shift assays provide additional information about protein stability under various buffer conditions, which correlates with functional integrity. Final validation should include biological assays specific to the pathways where odr-4 homolog functions, potentially involving Xenopus oocyte or embryo systems .

What are the critical considerations for designing experiments to study post-translational modifications of odr-4 homolog?

When designing experiments to study post-translational modifications (PTMs) of Xenopus tropicalis odr-4 homolog, researchers must address several critical parameters to ensure comprehensive and accurate characterization. The experimental design should incorporate:

  • Expression system selection: Eukaryotic expression systems (mammalian, insect, or yeast) are preferred over bacterial systems to capture the full range of potential PTMs. HEK293 or CHO cells provide mammalian PTM machinery, while Sf9 insect cells offer high expression yields with many conserved modifications.

  • PTM preservation strategies: Extraction and purification protocols must include protease inhibitors (PMSF, Aprotinin, Leupeptin) and phosphatase inhibitors (Sodium orthovanadate, Sodium fluoride) to prevent PTM loss during processing.

  • PTM detection methodologies: A multi-technique approach combining:

    • Mass spectrometry: LC-MS/MS analysis with enrichment strategies for specific modifications (TiO₂ columns for phosphopeptides, lectin affinity for glycopeptides)

    • Modification-specific antibodies: Western blotting with anti-phospho, anti-acetyl, or anti-ubiquitin antibodies

    • Specialized staining: Pro-Q Diamond for phosphorylation, periodic acid-Schiff for glycosylation

  • Site-directed mutagenesis: Mutation of predicted modification sites (serine/threonine for phosphorylation, lysine for acetylation/ubiquitination) to confirm functional relevance through comparative assays.

  • Physiological context: Analysis under different cellular conditions (stress, developmental stages, signaling activation) to capture condition-dependent modifications.

For phosphorylation studies specifically, in silico prediction tools suggest multiple potential phosphorylation sites in the odr-4 sequence that warrant experimental verification. The experimental workflow should include both global PTM profiling and targeted analysis of predicted modification sites .

What comparative analysis methods should be used when studying odr-4 homologs across different Xenopus species?

When conducting comparative analyses of odr-4 homologs across different Xenopus species, researchers should implement a multi-layered analytical framework that addresses sequence, structure, and functional dimensions. The methodological approach should include:

  • Sequence-based comparative analysis:

    • Multiple sequence alignment using CLUSTAL Omega or MUSCLE algorithms to identify conserved domains and species-specific variations

    • Phylogenetic tree construction using maximum likelihood or Bayesian methods to elucidate evolutionary relationships

    • Calculation of nonsynonymous to synonymous substitution ratios (dN/dS) to identify regions under selective pressure

  • Structural comparative analysis:

    • Homology modeling using tools like SWISS-MODEL or I-TASSER to predict three-dimensional structures

    • Molecular dynamics simulations to assess structural stability differences between species variants

    • Protein-protein interaction interface prediction to identify potentially altered binding surfaces

  • Expression pattern comparison:

    • Quantitative RT-PCR analysis of gene expression across equivalent developmental stages and tissues

    • In situ hybridization to visualize spatial expression differences

    • Western blot analysis to compare protein abundance and size variations

  • Functional comparative assays:

    • Cross-species complementation experiments to assess functional interchangeability

    • Binding affinity measurements for conserved interaction partners

    • Subcellular localization studies to identify potential differences in cellular distribution

How do the amino acid sequences of Xenopus tropicalis and Xenopus laevis odr-4 homologs differ, and what are the functional implications?

RegionX. tropicalis (Q0VA36)X. laevis (A3KNB6)Potential Functional Impact
N-terminal domain (positions 3-7)SYYVDDGSYYVDDRAltered charge distribution affecting protein-protein interactions
Mid-region (positions 12-18)KLIQQQKAKLVQQQKACModified hydrophobicity profile influencing conformational stability
Binding domain (positions 98-104)LRKLVFTVLRKLVFAVSubtle change in binding pocket architecture potentially affecting ligand specificity
Signaling motif (positions 260-266)VKCCGYIHVMKCRGFIHAltered recognition sequence affecting signal transduction efficiency
C-terminal domain (positions 440-446)IAVIISFYIAIIISFYModified membrane interaction properties at the transmembrane interface

These sequence variations potentially translate to functional differences in protein-protein interaction capabilities, subcellular localization patterns, and signaling pathway participation. The substitution patterns suggest species-specific adaptations in protein function while maintaining core activities, reflecting the evolutionary divergence between these closely related amphibian species. Researchers investigating odr-4 function should consider these variations when extrapolating findings between Xenopus species .

What bioinformatic tools and databases are most useful for analyzing the structure and function of odr-4 homolog proteins?

For comprehensive analysis of odr-4 homolog proteins, researchers should utilize a strategic combination of bioinformatic tools and databases tailored to different analytical dimensions. The recommended resources include:

  • Sequence Analysis and Annotation:

    • UniProt (Q0VA36 for X. tropicalis, A3KNB6 for X. laevis): Primary resource for curated protein information

    • BLAST and HMMER: For homology searches across species

    • Clustal Omega and MUSCLE: For multiple sequence alignments

    • ConSurf: For evolutionary conservation analysis

  • Structural Analysis:

    • SWISS-MODEL and I-TASSER: For homology-based structural modeling

    • PyMOL and UCSF Chimera: For structural visualization and analysis

    • PSIPRED and JPRED: For secondary structure prediction

    • TMHMM and TOPCONS: Specifically for transmembrane domain prediction crucial for odr-4's membrane association

  • Functional Prediction:

    • InterProScan: For identification of functional domains and motifs

    • NetPhos and PhosphoSitePlus: For phosphorylation site prediction

    • STRING and BioGRID: For protein-protein interaction network analysis

    • Gene Ontology Resource: For functional annotation

  • Evolutionary Analysis:

    • PAML and MEGA: For evolutionary rate analysis and phylogenetic tree construction

    • Ensembl Compara: For comparative genomics across vertebrate species

  • Expression Analysis:

    • Expression Atlas and Xenbase: For gene expression data across tissues and developmental stages

Integration of these computational resources enables generation of testable hypotheses regarding odr-4 homolog function, guiding experimental design for biochemical and cellular studies. For researchers new to bioinformatic analysis, workflow management platforms like Galaxy provide accessible interfaces for many of these tools without requiring programming expertise .

How can mass spectrometry be optimized for studying odr-4 homolog protein interactions and modifications?

Optimizing mass spectrometry (MS) protocols for studying odr-4 homolog protein interactions and modifications requires careful consideration of sample preparation, instrument parameters, and data analysis strategies. The recommended optimization approach includes:

  • Sample Preparation Optimization:

    • Crosslinking strategies: Implement formaldehyde (1-2%) or DSS (disuccinimidyl suberate) crosslinking to capture transient interactions before cell lysis

    • Immunoprecipitation conditions: Use gentle detergents (0.1% NP-40 or 0.5% CHAPS) to maintain membrane protein complexes while enabling solubilization

    • Digestion protocols: Compare trypsin, chymotrypsin, and elastase digestion to maximize sequence coverage, particularly for hydrophobic regions

    • Enrichment strategies: Implement TiO₂ chromatography for phosphopeptide enrichment and lectin affinity for glycopeptide isolation

  • MS Instrument Parameters:

    • Utilize nano-LC separation with extended gradients (120-180 minutes) for complex samples

    • Implement data-dependent acquisition with inclusion lists for predicted modification sites

    • Employ higher-energy collisional dissociation (HCD) combined with electron-transfer dissociation (ETD) for improved PTM site localization

    • Consider parallel reaction monitoring (PRM) for targeted analysis of specific peptides of interest

  • Data Analysis Workflow:

    • Use multiple search engines (Mascot, MaxQuant, and PEAKS) with appropriate settings for crosslinked peptides

    • Implement PTM site localization scoring (Ascore or ptmRS) with false discovery rate control

    • Apply label-free quantification for interaction dynamics studies

    • Utilize specialized software for crosslinked peptide identification (pLink or XlinkX)

  • Validation Strategy:

    • Confirm identified interaction partners through reciprocal pull-downs and Western blotting

    • Validate PTM sites using site-directed mutagenesis and functional assays

    • Implement heavy-labeled synthetic peptides as internal standards for absolute quantification

This comprehensive approach enables detailed characterization of odr-4 protein complexes and modification patterns with high confidence, providing insights into functional mechanisms at the molecular level .

What are the current applications of Recombinant Xenopus tropicalis Protein odr-4 homolog in developmental biology research?

Recombinant Xenopus tropicalis Protein odr-4 homolog has emerged as a valuable tool in developmental biology research, contributing to several key investigative areas. Current applications include:

  • Membrane protein trafficking studies: The odr-4 homolog serves as a model for investigating mechanisms of membrane protein localization during embryonic development, particularly in neural tissue formation. Researchers utilize the recombinant protein in combination with fluorescent tags to track dynamic distribution patterns throughout developmental stages.

  • Embryonic cell signaling research: Evidence suggests involvement of odr-4 homolog in developmental signaling pathways, making the recombinant protein valuable for reconstitution experiments examining signal transduction mechanisms unique to amphibian development. These studies help elucidate conserved versus species-specific signaling components across vertebrate evolution.

  • Functional domain mapping: Structure-function analyses using recombinant odr-4 fragments help identify critical domains required for protein-protein interactions during developmental processes. These experiments typically employ domain deletion variants to determine minimal functional units.

  • Developmental proteomics applications: The recombinant protein serves as a valuable bait in pull-down experiments designed to identify stage-specific protein interaction networks that evolve throughout developmental progression. This approach has revealed previously uncharacterized protein complexes involved in tissue differentiation.

  • Comparative evolutionary developmental biology: The availability of recombinant odr-4 homologs from both X. tropicalis and X. laevis facilitates comparative studies examining functional conservation and divergence of developmental mechanisms between these closely related species with different ploidy levels.

These research applications collectively enhance understanding of fundamental developmental processes while providing insights into evolutionary conservation of protein trafficking and membrane organization mechanisms across vertebrate species .

How can researchers design experiments to elucidate the role of odr-4 homolog in Xenopus neural development?

Designing experiments to elucidate the role of odr-4 homolog in Xenopus neural development requires a multi-faceted approach combining loss-of-function, gain-of-function, and localization studies across developmental stages. A comprehensive experimental design should include:

  • Temporal expression profiling:

    • Quantitative RT-PCR analysis of odr-4 expression across developmental stages (from blastula to tadpole)

    • Whole-mount in situ hybridization to map spatial expression patterns within developing neural tissues

    • Western blot analysis with stage-specific protein extracts to correlate transcript with protein levels

  • Loss-of-function analysis:

    • Morpholino oligonucleotide (MO) knockdown targeting odr-4 mRNA translation or splicing

    • CRISPR/Cas9-mediated gene editing to generate targeted mutations

    • Dominant-negative approach using overexpression of truncated odr-4 variants lacking functional domains

  • Phenotypic assessment of neural development:

    • Neural marker analysis (Sox2, Pax6, N-tubulin) in control versus odr-4-depleted embryos

    • Time-lapse imaging of neural plate and neural tube formation

    • Detailed neuroanatomical analysis using tissue-specific markers

    • Behavioral assays in tadpoles to assess functional consequences of neural defects

  • Rescue experiments:

    • Co-injection of MO-resistant odr-4 mRNA to confirm specificity

    • Structure-function analysis through rescue with mutated versions of odr-4

    • Cross-species rescue using X. laevis odr-4 in X. tropicalis embryos

  • Protein interaction studies in neural context:

    • Co-immunoprecipitation from neural tissue extracts

    • Proximity labeling (BioID) with neural-specific promoters

    • Yeast two-hybrid screening using neural cDNA libraries

  • Subcellular localization in neural cells:

    • Immunofluorescence microscopy in neural tissue sections

    • Live imaging of fluorescently tagged odr-4 in explanted neural tissue

    • Electron microscopy with immunogold labeling for high-resolution localization

This comprehensive experimental approach enables correlation of molecular mechanisms with developmental outcomes, providing insights into the specific contributions of odr-4 homolog to neural development processes in Xenopus .

What are the emerging trends in research involving comparative analysis of odr-4 homologs across different species?

Emerging research trends involving comparative analysis of odr-4 homologs across different species reveal evolving methodological approaches and conceptual frameworks. Current trends include:

  • Integrated multi-omics approaches: Contemporary studies increasingly combine genomic, transcriptomic, proteomic, and interactomic analyses to create comprehensive functional profiles of odr-4 homologs across species. This integration enables identification of conserved regulatory networks and species-specific adaptations in protein function.

  • Single-cell resolution comparative analyses: Advanced single-cell RNA sequencing techniques now allow comparison of odr-4 expression patterns at cellular resolution across species, revealing previously undetected cell-type specific functions that may vary between organisms despite sequence conservation.

  • Structural biology convergence: Cryo-electron microscopy and AlphaFold2 predictions are increasingly being applied to compare odr-4 structural features across species, moving beyond primary sequence comparisons to three-dimensional structural conservation analysis.

  • CRISPR-based functional genomics: Parallel CRISPR knockout or knockin experiments in multiple species simultaneously allow direct comparison of phenotypic consequences, particularly valuable for comparing Xenopus tropicalis (diploid) with Xenopus laevis (allotetraploid) function.

  • Evolutionary developmental biology applications: Comparative studies now frequently incorporate evolutionary rate analysis with selection pressure metrics to identify functionally critical regions versus rapidly evolving domains across species lineages.

  • Cross-species interactome conservation: Systematic analysis of protein-protein interaction networks involving odr-4 homologs across species now employs standardized affinity purification mass spectrometry protocols to quantify both conserved and divergent interaction patterns.

  • Developmental timing comparison: Studies increasingly examine not just spatial expression patterns but temporal dynamics of odr-4 activity across equivalent developmental milestones in different species, revealing heterochronic shifts in protein function.

These emerging approaches collectively enhance understanding of how evolutionary processes have shaped odr-4 function while maintaining critical activities across diverse species contexts .

What are the most promising future directions for research involving Xenopus tropicalis Protein odr-4 homolog?

Future research involving Xenopus tropicalis Protein odr-4 homolog presents several promising directions that leverage emerging technologies and conceptual frameworks. The most significant opportunities include:

  • Integrative structural biology approaches combining cryo-electron microscopy, X-ray crystallography, and molecular dynamics simulations to resolve the complete three-dimensional structure of odr-4 homolog, particularly focusing on membrane-associated domains that have been challenging to characterize.

  • Development of optogenetic tools incorporating odr-4 functional domains to enable precise spatiotemporal control of protein trafficking and membrane organization in live embryos, providing unprecedented insights into dynamic developmental processes.

  • Expansion of comparative genomics approaches to examine odr-4 homolog function across broader evolutionary distances, including mammals, fish, and invertebrates, to elucidate deeply conserved mechanisms versus lineage-specific adaptations.

  • Implementation of advanced genome editing technologies, including base editing and prime editing, to introduce precise mutations corresponding to predicted functional domains in vivo, enabling nuanced phenotypic analysis beyond traditional knockout approaches.

  • Application of spatial transcriptomics and proteomics methods to map odr-4 function within the three-dimensional context of developing tissues, correlating molecular activities with tissue architecture formation.

  • Development of synthetic biology approaches utilizing engineered odr-4 variants as scaffolds for directing protein complex assembly or membrane organization in custom-designed cellular systems.

These future directions collectively promise to transform understanding of odr-4 homolog from a descriptive to a mechanistic level, with potential applications in developmental biology, evolutionary biology, and potentially regenerative medicine contexts where controlled protein trafficking and membrane organization are essential .

How can researchers effectively integrate bioinformatics and wet-lab approaches in studying odr-4 homolog function?

Effective integration of bioinformatics and wet-lab approaches for studying odr-4 homolog function requires implementation of an iterative research cycle with bidirectional information flow. Optimal integration strategies include:

  • Hypothesis generation through computational prediction:

    • Utilize evolutionary conservation analysis to identify functionally critical residues

    • Apply protein-protein interaction prediction algorithms to identify potential binding partners

    • Implement molecular dynamics simulations to predict conformational changes under different conditions

    • Generate testable hypotheses based on in silico predictions

  • Strategic experimental design guided by computational insights:

    • Prioritize residues for mutagenesis based on conservation scores and predicted functional importance

    • Design truncation constructs informed by domain prediction algorithms

    • Select experimental conditions based on predicted protein stability parameters

    • Develop targeted proteomic assays focusing on computationally predicted modification sites

  • Iterative data analysis and refinement:

    • Incorporate experimental results into machine learning models to improve prediction accuracy

    • Refine structural models based on empirical biochemical data

    • Develop custom analysis pipelines integrating multiple data types (sequence, structure, interaction)

    • Implement Bayesian approaches to update functional predictions as new experimental evidence emerges

  • Technical implementation strategies:

    • Establish standardized data formatting and nomenclature across computational and experimental platforms

    • Implement laboratory information management systems (LIMS) that capture both computational predictions and experimental results

    • Utilize electronic lab notebooks with computational integration capabilities

    • Develop visualization tools that can represent both in silico predictions and experimental validation

  • Collaborative framework:

    • Establish cross-disciplinary teams with expertise in both computational biology and experimental biochemistry

    • Implement regular joint analysis sessions to interpret complex datasets

    • Develop shared conceptual models that bridge computational abstractions and experimental realities

This integrated approach maximizes research efficiency by focusing experimental efforts on high-probability targets while continuously refining computational models based on empirical results, creating a virtuous cycle of increasingly accurate functional characterization .

What methodological advances are needed to address current limitations in studying odr-4 homolog proteins?

Addressing current limitations in studying odr-4 homolog proteins requires strategic methodological advances across multiple technical domains. The most critical methodological needs include:

  • Improved membrane protein structural biology techniques:

    • Development of specialized detergent-free solubilization methods compatible with odr-4's hydrophobic domains

    • Adaptation of lipid nanodisc technologies specifically optimized for amphibian membrane proteins

    • Implementation of hydrogen-deuterium exchange mass spectrometry protocols for mapping membrane-interaction surfaces

  • Enhanced in vivo imaging capabilities:

    • Development of bright, minimally disruptive fluorescent tags compatible with odr-4's membrane association properties

    • Adaptation of super-resolution microscopy techniques for amphibian embryonic tissues

    • Implementation of correlative light and electron microscopy workflows for Xenopus samples

  • Advanced functional genomics tools:

    • Creation of tissue-specific and inducible CRISPR systems optimized for Xenopus models

    • Development of single-cell genomic modification techniques compatible with early embryonic cells

    • Establishment of high-throughput phenotyping platforms for Xenopus embryos and tadpoles

  • Improved protein interaction detection methods:

    • Development of proximity labeling techniques optimized for membrane-associated protein complexes

    • Adaptation of thermal proximity coaggregation (TPCA) methods for amphibian cellular systems

    • Implementation of fractionation-resistant interaction detection techniques for membrane proteins

  • Enhanced computational prediction algorithms:

    • Development of amphibian-specific protein structure prediction tools

    • Creation of specialized algorithms for predicting membrane protein topology in Xenopus systems

    • Implementation of machine learning approaches for predicting species-specific interaction partners

  • Standardized recombinant protein production:

    • Establishment of optimized expression systems specifically for amphibian membrane proteins

    • Development of automated purification protocols maintaining native-like lipid environments

    • Creation of activity assays specifically designed for odr-4 functional assessment

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.