Recombinant Xenopus tropicalis Protein tweety homolog 1 (ttyh1)

Shipped with Ice Packs
In Stock

Description

Ion Channel Activity

Recombinant ttyh1 forms chloride channels that regulate cellular responses to osmotic stress and volume changes. In mammalian systems, homologs like human TTYH1 contribute to volume-regulated anion currents (VRAC), which are implicated in cancer progression and neuronal signaling .

Developmental and Tissue-Specific Expression

In Xenopus embryos, endogenous ttyh1 is expressed at late neurula stages, localizing to:

  • Nervous system: Ventricular zones of the brain and spinal cord (proliferative regions) .

  • Somites: Transient expression during early muscle development .

  • Sensory organs: Eye and cranial ganglia in tadpoles .

This spatial-temporal pattern aligns with its role in neuritogenesis and cell adhesion during early development .

Disease Association

  • Cancer: TTYH1 mediates VRAC currents in gastric cancer cells (e.g., SNU-601 and LoVo lines), influencing tumor growth and metastasis .

  • Neurological Disorders: Linked to pediatric brain tumors and Parkinson’s disease via dysregulated calcium signaling .

Experimental Tools

ApplicationUse CaseSource
ELISA KitsQuantitative detection of ttyh1 in biological samples
Antibody ProductionGeneration of blocking peptides or immunohistochemistry reagents
Ion Channel StudiesElectrophysiological analysis of VRAC currents in cancer cell models
RNA InterferencesiRNA-mediated knockdown in human cell lines (e.g., hTTYH1)

Pathway Involvement

Recombinant ttyh1 interacts with pathways critical for:

PathwayRelated ProteinsSource
Ion Channel TransportCLCN1, SLC26A6, TRPC4AP
Stimuli-Sensing ChannelsGSDMA2, TRDN, CLCN6
Transmembrane TransportSLCO4C1, AQP10, SLC30A2

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
ttyh1; Protein tweety homolog 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-449
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
ttyh1
Target Protein Sequence
MSSSHGYRASWWTYILHQVPHTNFQFEVVDNQFAPQEWPYQQALLFLASIAGLCLAISLI LICVYLIRFCCCSSQEDDDSKSHRVCCVTWSCVAAVIICCAGIGIGFYGNSETNDGVYQV TYSLMNANHTLTSINLLISDTVELLSSVVRSDLTQLEEIFSKRTEFLVMIRNTRRQVESV AQQLAEISFWKGPEPNPNALAEQVNFIEDYRWLAYILLLLLDLIICLFTLLGLAKQIKWL VIVMTVVSFFVLLLSWGSMGLEMATAVGLSDFCSDPDAYVMNQTQAITNINPDILQYYIS CNQDVTNPFRQRLTMSQRALSNIHSQLHGLEREAVPQFPTAEKNLLVVQGMLNTTEGNFH HLVALLNCRGLHKDYVDALKGLCYDGMEGILFLLLFSFLSALSFTAAICSLPRAWKRFQN RDLDYDDMDEDDPFNPQESKRFVQWQSSI
Uniprot No.

Target Background

Function

Probable chloride channel.

Database Links

KEGG: xtr:780361

UniGene: Str.53985

Protein Families
Tweety family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure and function of Xenopus tropicalis Protein tweety homolog 1 (ttyh1)?

Xenopus tropicalis Protein tweety homolog 1 (ttyh1) belongs to the tweety family of genes that encodes large-conductance chloride channels . The protein contains multiple transmembrane domains with a structure that differs from ttyh3 but shares more similarity with ttyh2 at both amino acid and predicted protein levels . Functionally, ttyh1 has been implicated in multiple cellular processes including cell division, cell adhesion, regulation of calcium activity, and is associated with tumorigenesis, particularly in neuronal cells . The protein plays significant roles in neuritogenesis, dynamic filipodia-like protrusions formation, and maintenance of neural stem cell properties .

How is ttyh1 expressed during Xenopus embryonic development?

Ttyh1 expression in Xenopus follows a specific developmental pattern:

  • Maternal expression: ttyh1 does not display significant maternal expression

  • Initial expression: onset at late neurula stages

  • Expression progression: dramatically increased neural-specific expression through swimming tadpole stages

  • Spatial localization: consistently and tightly localized to the ventricular regions of the developing nervous system, where cells are mitotic

  • By swimming tadpole stages: expressed in brain, spinal cord, eye, and cranial ganglia, with specific restriction to proliferative ventricular zones

  • Transient expression: also observed in somites during development

This expression pattern coincides approximately with the timing of neurite formation in Xenopus .

What experimental methods are most effective for studying ttyh1 expression in Xenopus?

For effective characterization of ttyh1 expression in Xenopus, the following methodological approaches are recommended:

  • RT-PCR: Using primers designed from cDNA clone sequences of Xenopus laevis mRNA from tweety homologs. Sequences can be obtained from NCBI Reference Sequences (accession number for ttyh1: NM_001093946), with primers designed to produce PCR products approximately one kilobase in length .

  • Whole mount in situ hybridization (ISH): For spatial localization of ttyh1 expression. Ensure probe specificity by confirming minimal identity with other tweety family members (the highest being 24% in previous studies) .

  • Fluorescent in situ hybridization (FISH): For co-localization studies with other markers, as demonstrated in studies examining co-localization of Ttyh1 with markers such as CGRP and IB4 .

  • qRT-PCR: For quantitative analysis of expression levels across developmental stages, particularly useful for detecting low levels of expression that may not be visible by ISH .

  • RNA-Seq: For comprehensive transcriptomic analysis, as utilized in the Xenopus tropicalis transcriptome database to track expression dynamics through development .

What is the relationship between ttyh1 and the Notch signaling pathway?

Ttyh1 has a complex relationship with the Notch signaling pathway that appears bidirectional:

  • Upstream regulation: Ttyh1 maintains neural stem cell properties by increasing the expression of direct downstream targets of Notch following overexpression in neural progenitor cells . Mechanistically, ttyh1 increases Notch IntraCellular Domain (NICD) production through the degradation of RER1, which subsequently increases maturation of γ-secretase complexes .

  • Downstream regulation: Microarray analysis has shown that ttyh1 expression is significantly upregulated in late neurula stage Xenopus laevis embryos after over-expressing NICD . Additionally, treatment of mouse neurospheres with a γ-secretase inhibitor (which downregulates Notch activity) caused downregulation of ttyh1 at both mRNA and protein levels .

The exact positioning of ttyh1 in the Notch pathway—whether upstream or downstream of NICD activation, or potentially involved in an auto-regulatory loop—remains an open question requiring further investigation .

How does ttyh1 contribute to nociception and pain processing, and what methodologies can investigate this function?

Ttyh1 serves as a critical determinant of acute nociception and pain sensitization, particularly during peripheral inflammation . Research methodologies to investigate this function include:

  • Genetic approaches:

    • Generation of Ttyh1-deficient mice to evaluate changes in pain sensitivity

    • Nociceptor-specific targeting of Ttyh1 to distinguish central versus peripheral effects

  • Electrophysiological methods:

    • Patch-clamp recordings to measure nociceptor excitability and synaptic transmission between nociceptors and spinal neurons

    • Analysis of paired-pulse ratio and miniature excitatory postsynaptic currents to evaluate presynaptic function

  • Molecular and cellular characterization:

    • FISH analysis to examine co-localization with nociceptor markers (CGRP, IB4)

    • Quantification of Ttyh1 expression changes (mRNA and protein levels) following inflammatory challenge

  • Behavioral assays:

    • Assessment of basal nociceptive responses

    • Evaluation of spontaneous nociception, hyperalgesia, and allodynia following inflammatory challenges

Research findings demonstrate that Ttyh1 is extensively expressed in CGRP-expressing peptidergic and IB4-binding non-peptidergic nociceptive DRG neurons and their presynaptic central terminals . Following peripheral inflammation, Ttyh1 shows dramatic upregulation at both mRNA and protein levels in the DRG and spinal dorsal horn .

What approaches can be used to distinguish the functions of different tweety family proteins in Xenopus?

Distinguishing between the functions of ttyh1, ttyh2, and ttyh3 requires careful experimental design:

  • Expression pattern analysis:

    • Comparative whole mount in situ hybridization using highly specific probes (ensure <24% sequence identity between family members)

    • Temporal expression profiling using qRT-PCR and RNA-Seq to identify stage-specific expression differences

    • Spatial mapping to identify distinct localization patterns (e.g., ttyh1 in proliferative ventricular zones vs. ttyh3 in postmitotic regions)

  • Structural and functional comparisons:

    • Analysis of transmembrane structure differences (ttyh3 has a different structure compared to ttyh1 and ttyh2)

    • Examination of evolutionary relationships (ttyh3 homologs are more distant, having diverged prior to a duplication event that led to ttyh1 and ttyh2)

  • Genetic manipulation:

    • Gene-specific knockdown or knockout to evaluate differential phenotypes

    • Rescue experiments to assess functional redundancy or specificity

The distinct expression patterns observed between tweety family members suggest they play different roles during embryonic development:

  • ttyh1: restricted to proliferative, ventricular zones in the developing nervous system

  • ttyh2: strongly expressed in cranial ganglia V, VII, IX and X

  • ttyh3: primarily localized to postmitotic regions of the developing nervous system

What are the methodological considerations for analyzing ttyh1's role in neural stem cell maintenance?

To effectively study ttyh1's role in neural stem cell maintenance, researchers should consider the following methodological approaches:

  • Overexpression studies:

    • Use retroviral vectors containing the murine stem cell virus long terminal repeat to drive ttyh1 overexpression in neural progenitor cells

    • Assess neurosphere frequency as a measure of neural stem cell properties

  • Pathway analysis:

    • Evaluate expression of Notch downstream targets following ttyh1 manipulation

    • Measure NICD production through western blot using α-NICD antibodies

    • Analyze RER1 degradation and γ-secretase complex maturation following ttyh1 manipulation

  • Inhibitor studies:

    • Use γ-secretase inhibitors to downregulate Notch activity and assess effects on ttyh1 expression

    • Employ specific inhibitors of ttyh1 to evaluate effects on neural stem cell properties

  • Expression analysis in developing embryos:

    • Track ttyh1 expression in ventricular zones where cells are mitotic

    • Correlate expression patterns with known markers of neural stem cells

Research has demonstrated that overexpression of Ttyh1 in mouse E14.5 primary neural progenitors increases neurosphere frequency, supporting its role in maintaining neural stem cell properties .

What are the challenges in producing and characterizing recombinant Xenopus tropicalis ttyh1 protein?

Production and characterization of recombinant Xenopus tropicalis ttyh1 protein present several challenges that researchers should address:

  • Design of expression constructs:

    • Primers for PCR should be designed from cDNA clone sequences of Xenopus ttyh1 mRNA

    • NCBI Reference Sequences can provide the basis for design (e.g., NM_001093946 for X. laevis)

    • Ensure primers are both unique to ttyh1 and highly conserved to recognize all possible variants

  • Expression systems considerations:

    • Select appropriate expression systems that can accommodate membrane proteins with multiple transmembrane domains

    • Consider codon optimization for the expression system being used

    • Include appropriate tags for purification while ensuring they don't interfere with protein function

  • Functional characterization:

    • Design assays to measure large-conductance chloride channel activity

    • Evaluate protein-protein interactions, particularly with components of the Notch signaling pathway

    • Assess protein localization in cellular compartments

  • Species-specific considerations:

    • Note that X. laevis is allotetraploid with homeologous pairs for ttyh1 (ttyh1.s encoding Ttyh1b, and ttyh1.l encoding Ttyh1a), while X. tropicalis is diploid

    • Consider potential functional differences between these variants when designing experiments

How can site-directed mutagenesis of recombinant ttyh1 be used to study structure-function relationships?

Site-directed mutagenesis offers powerful insights into ttyh1 structure-function relationships:

  • Target selection for mutagenesis:

    • Focus on conserved residues across species to identify functionally important amino acids

    • Consider arginine residues analogous to Arginine 165 in mouse Ttyh1, which has been identified as necessary for channel-pore formation

    • Target amino acids in loop regions, which may be involved in channel function

  • Mutagenesis strategies:

    • Employ systematic 20 amino acid truncations to identify domains essential for function

    • Create point mutations of specific conserved residues

    • Design chimeric proteins between different tweety family members to identify domain-specific functions

  • Functional assays:

    • Measure anion current for each mutation variant

    • Assess protein-protein interactions to identify interaction domains

    • Evaluate cellular localization to determine trafficking signals

  • Data analysis:

    • Compare functional changes across mutations to establish structure-function maps

    • Correlate findings with evolutionary conservation data

    • Develop predictive models of protein function based on structural features

Previous research in mice has successfully identified critical amino acids for channel-pore formation through systematic truncations followed by anion current measurements .

How should expression data for ttyh1 across developmental stages be analyzed and interpreted?

Analysis of ttyh1 expression across developmental stages requires careful methodological consideration:

  • Temporal expression analysis:

    • Compare qRT-PCR, RNA-Seq, and in situ hybridization data across developmental stages

    • Account for sensitivity differences between methods (qRT-PCR may detect expression where ISH shows no signal)

    • Normalize expression levels appropriately for each method

  • Spatial expression analysis:

    • Map expression domains in relation to known anatomical structures and developmental markers

    • Consider the relationship between expression and functional processes (e.g., ttyh1 expression in ventricular zones correlates with cell proliferation)

  • Comparative analysis with other tweety family members:

    • Create expression matrices comparing ttyh1, ttyh2, and ttyh3 across developmental stages and tissues

    • Identify unique and overlapping expression domains

GeneCleavage/Early BlastulaMid-Blastula TransitionGastrulationNeurulationSwimming TadpoleExpression Domains
ttyh1Very low/absentSlightly elevatedLowOnset of expressionDramatically increasedVentricular zones, brain, spinal cord, eye, cranial ganglia
ttyh2Absent throughout blastulaAbsent throughout blastulaLowDetectablePresentCranial ganglia V, VII, IX, X
ttyh3Increase at MBTElevatedModeratePresentPresentPostmitotic regions of nervous system

Data compiled from studies in Xenopus laevis and Xenopus tropicalis

What criteria should be used to evaluate the functional significance of ttyh1 in different experimental contexts?

When evaluating ttyh1's functional significance across different experimental contexts, consider these methodological criteria:

  • Loss-of-function experiments:

    • Assess phenotypic changes following targeted disruption of ttyh1

    • Evaluate tissue-specific effects using conditional knockout approaches

    • Consider compensatory mechanisms from other tweety family members

  • Gain-of-function experiments:

    • Measure effects of ttyh1 overexpression on cellular processes

    • Assess dose-dependent responses to determine sensitivity thresholds

    • Evaluate context-specific effects across different cell types or developmental stages

  • Molecular interaction studies:

    • Identify direct protein-protein interactions with ttyh1

    • Map changes in downstream signaling pathways following ttyh1 manipulation

    • Assess co-expression patterns with functionally related genes

  • Physiological relevance:

    • Correlate experimental findings with known physiological processes

    • Establish causal relationships through rescue experiments

    • Consider species-specific differences when translating findings

Research using these approaches has successfully demonstrated ttyh1's functional significance in:

  • Neural stem cell maintenance through Notch signaling

  • Nociception and pain processing

  • Embryonic neural development

How can researchers address the conflicting evidence about ttyh1's position in the Notch signaling pathway?

To reconcile contradictory findings regarding ttyh1's relationship with Notch signaling:

  • Experimental design considerations:

    • Use temporally controlled manipulations to determine the sequence of events

    • Employ multiple complementary approaches (genetic, pharmacological, biochemical)

    • Consider cellular context and developmental stage in experimental design

  • Specific methodologies:

    • Real-time monitoring of NICD production following ttyh1 manipulation

    • Chromatin immunoprecipitation to determine if NICD directly regulates ttyh1 transcription

    • Proximity ligation assays to detect direct protein interactions

    • Time-course experiments to establish temporal relationships

  • Integrative analysis:

    • Develop a model that includes feedback loops or context-specific regulation

    • Test predictions of the model with targeted experiments

    • Consider species-specific differences when comparing results across model systems

Current evidence suggests a complex relationship where ttyh1 may both regulate Notch signaling (by increasing NICD production through RER1 degradation) and be regulated by Notch (as ttyh1 expression is upregulated following NICD overexpression) . The possibility of an auto-regulatory loop should be considered and directly tested.

What experimental approaches can determine whether ttyh1's role in pain processing is primarily central, peripheral, or both?

To dissect ttyh1's role in different components of the pain processing pathway:

  • Tissue-specific genetic manipulation:

    • Use Cre-loxP systems with nociceptor-specific promoters (e.g., Nav1.8-Cre) to target peripheral nociceptors

    • Employ spinal cord-specific manipulations to target central components

    • Compare phenotypes between global and tissue-specific ttyh1 disruption

  • Electrophysiological approaches:

    • Measure effects of ttyh1 manipulation on nociceptor excitability (peripheral)

    • Assess synaptic transmission at identified synapses between nociceptors and spinal neurons (central)

    • Analyze paired-pulse ratio and miniature excitatory postsynaptic currents to evaluate presynaptic mechanisms

  • Behavioral assessment:

    • Compare inflammatory and neuropathic pain models

    • Assess both reflexive and affective pain behaviors

    • Evaluate acute nociception versus persistent pain states

Current research demonstrates that ttyh1 affects both peripheral mechanisms (nociceptor excitability) and central mechanisms (synaptic transmission at nociceptor-spinal neuron synapses), with interfering with ttyh1 specifically in nociceptors producing pain relief .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.