Recombinant Xenopus tropicalis Protein YIF1B (yif1b)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Processes

YIF1B is implicated in:

  • Vesicle Trafficking: Mediates ER-to-Golgi transport and influences Golgi structure .

  • Neurodevelopment: Knockout studies in mice link YIF1B loss to cerebellar atrophy, myelination defects, and ventriculomegaly, suggesting conserved roles in neuronal health .

  • Primary Cilia Function: Biallelic YIF1B mutations cause cilia abnormalities in patient fibroblasts and mouse models, bridging Golgi dysfunction with ciliopathies .

3.1. Mechanistic Studies

  • Protein Trafficking: Used to study YIF1B’s role in serotonin receptor (HTR) trafficking and signal transmission .

  • Immune Regulation: Correlated with immune checkpoint gene expression (e.g., CD276, TNFRSF family) in cancer models, though direct evidence in Xenopus is pending .

3.2. Disease Modeling

  • Neurodevelopmental Disorders: YIF1B mutations are linked to post-natal encephalopathy, motor delays, and visual deficits in humans .

  • Ciliopathies: Aberrant YIF1B expression disrupts ciliary architecture, providing a model for studying Golgi-cilia cross-talk .

Comparative Analysis Across Species

SpeciesYIF1B FunctionKey Findings
Xenopus tropicalisER-Golgi trafficking, cilia regulationFull-length recombinant protein available for structural studies .
HumanNeurodevelopment, immune modulationHigh expression in cancers (e.g., LIHC, KIRC); prognostic biomarker .
MouseNeuronal survival, myelinationKnockout causes cerebellar atrophy and ventriculomegaly .

Future Directions

  • Therapeutic Targeting: YIF1B’s role in serotonin signaling and immune regulation positions it as a candidate for cancer or neurodevelopmental disorder therapies .

  • Structural Studies: Crystallization of recombinant YIF1B could clarify its interaction with HTRs and trafficking machinery .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment according to your needs.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested. Please contact us in advance; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
yif1b; Protein YIF1B; YIP1-interacting factor homolog B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-300
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
yif1b
Target Protein Sequence
MNQESSFRAPPKRRVRGPNPNISTPHQLFDDTSGGPVPHGGEYPNHSSPALGIPAQAFLS EPMSNFAMAYGSSLASQGKEMMDKNIDRIIPVSKIKYYFAVDTVYVGKKIGLLMFPYMHQ DWEVRYQQDTPVAPRFDINAPDLYIPVMAFITYILVAGLALGTQSRFSPEILGMQASSAL AWLIVEVLAILLSLYLVTVNTDLTTVDLVAFSGYKYVGMISGVISGLLFGKTGYYVVLSW CGISVVFFMIRTLRLKILSEAAAEGVLVRGARNQLRMYLTMAIAAVQPIFMYWLTYHLVR
Uniprot No.

Target Background

Function
Involved in anterograde trafficking from the endoplasmic reticulum to the plasma membrane and the organization of Golgi architecture.
Database Links
Protein Families
YIF1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

How does Xenopus tropicalis serve as a model organism for YIF1B studies?

Xenopus tropicalis offers several advantages for studying YIF1B function compared to other Xenopus species. Unlike Xenopus laevis, which has an allotetraploid genome that complicates genetic analysis, X. tropicalis possesses a diploid genome making it more suitable for genetic manipulation and analysis . Additionally, X. tropicalis has a shorter generation time, facilitating faster experimental timelines for genetic studies .

The developmental processes in X. tropicalis occur at similar rates to X. laevis, although X. tropicalis tolerates a narrower temperature range. This similarity allows researchers to apply the Nieuwkoop and Faber developmental staging system established for X. laevis to X. tropicalis . Furthermore, many analytical reagents developed for X. laevis, including antibodies and molecular probes, can be effectively used with X. tropicalis, enabling researchers to leverage existing resources while studying YIF1B .

What is the expression pattern of YIF1B in Xenopus tropicalis tissues?

While the search results don't provide specific data on YIF1B expression patterns across all X. tropicalis tissues, related research in rat models indicates that YIF1B mRNA is highly expressed in brain tissue, particularly in neurons expressing the serotonin 5-HT1A receptor . By extension, a similar expression pattern might be expected in X. tropicalis, with highest expression in neural tissues, though species-specific differences may exist.

For comprehensive tissue expression profiling, researchers should employ whole-mount in situ hybridization techniques, which have been successfully applied to X. tropicalis without modification from X. laevis protocols . This method would allow visualization of yif1b gene expression across different developmental stages and tissue types.

What role does YIF1B play in serotonin receptor trafficking in neuronal systems?

YIF1B has been identified as a critical protein for the proper dendritic targeting of the 5-HT1A serotonin receptor in neurons. Research shows that YIF1B directly interacts with the C-terminal domain of the 5-HT1A receptor, as demonstrated through yeast two-hybrid screening and GST pull-down experiments with brain extracts . This interaction appears essential for the trafficking pathway that delivers 5-HT1A receptors to distal portions of neuronal dendrites.

The protein's function is highly specific, as inhibition of YIF1B expression via small interfering RNA (siRNA) in primary neuron cultures specifically prevents the targeting of 5-HT1A receptors to distal dendrites without affecting the trafficking of other receptors such as sst2A, P2X2, and 5-HT3A . This suggests that YIF1B participates in a selective trafficking mechanism rather than affecting general dendritic protein transport.

Colocalization experiments have shown that YIF1B and 5-HT1A receptors are found together in small vesicles involved in transient intracellular trafficking, supporting YIF1B's direct role in the physical transport of these receptors . This finding has significant implications for understanding the regulation of serotonergic signaling in the nervous system, which is relevant to numerous neuropsychiatric conditions.

How can genetic modifications of YIF1B in Xenopus tropicalis inform neuronal trafficking mechanisms?

Gene editing techniques such as CRISPR/Cas9 have proven highly effective in Xenopus models due to their external fertilization and efficiency of RNA and protein microinjection into synchronous embryos . For YIF1B studies, CRISPR/Cas9-mediated gene editing can be employed to generate YIF1B knockout or mutant X. tropicalis models to study the effects on receptor trafficking in vivo.

The production of simple insertions and deletions (indels) in the yif1b gene can be accomplished with high efficiency in X. tropicalis, with penetrance often exceeding 90% when measured using TIDE (Tracking of Indels by Decomposition) . Although F0 animals exhibit mosaicism due to the rapid cell divisions that occur every 30 minutes in early development, they still provide valuable models for studying YIF1B function.

When designing experiments to study YIF1B's role in trafficking, researchers should consider:

  • Using inbred X. tropicalis strains to increase CRISPR/Cas9 efficiency by reducing polymorphisms in target regions

  • Employing fluorescent protein tagging to track YIF1B localization in real-time

  • Comparing phenotypes between YIF1B-deficient animals and those with specific mutations in protein interaction domains

  • Examining effects on multiple receptor types to determine specificity of trafficking defects

What structural features of YIF1B are critical for its function in the ER/Golgi trafficking machinery?

The YIF1B protein contains several key structural features that contribute to its function in membrane protein trafficking. Based on its amino acid sequence, YIF1B includes transmembrane domains that likely anchor it within the membranes of trafficking vesicles . These domains are critical for its function in the ER/Golgi trafficking machinery.

The protein-protein interaction domains of YIF1B enable it to bind to the C-terminal tail of the 5-HT1A receptor, as demonstrated through experimental methods . This interaction is essential for the proper targeting of the receptor to neuronal dendrites.

While the specific structural motifs within YIF1B that determine its selectivity for certain cargo proteins (like 5-HT1A receptor) have not been fully characterized in the provided search results, researchers can investigate these through:

  • Mutation analysis of conserved residues

  • Creation of chimeric proteins with related trafficking factors

  • Structural studies using X-ray crystallography or cryo-electron microscopy

  • In silico modeling of protein interactions

What are the optimal techniques for studying YIF1B protein-protein interactions in Xenopus tropicalis?

Several established techniques can be effectively applied to study YIF1B interactions in X. tropicalis:

Yeast Two-Hybrid Screening: This technique has successfully identified YIF1B as an interacting partner of the 5-HT1A receptor C-terminus . For X. tropicalis studies, researchers can use this approach to screen for additional interacting proteins by creating a cDNA library from X. tropicalis tissues.

GST Pull-Down Assays: These have confirmed YIF1B interaction with the 5-HT1A receptor in rat brain extracts . The technique can be adapted for X. tropicalis by expressing GST-tagged YIF1B and incubating with X. tropicalis tissue extracts to identify binding partners.

Co-Immunoprecipitation: For in vivo validation of interactions, co-immunoprecipitation of YIF1B with suspected partner proteins from X. tropicalis brain extracts can provide strong evidence of physiological interactions.

Colocalization Studies: Immunofluorescence microscopy using antibodies against YIF1B and potential interacting proteins can demonstrate spatial proximity in cellular compartments. The established protocols for X. laevis can be directly applied to X. tropicalis .

Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein interactions in living cells by fusing complementary fragments of a fluorescent protein to potential interacting partners.

How can CRISPR/Cas9 be optimally employed to study YIF1B function in Xenopus tropicalis?

CRISPR/Cas9 gene editing in X. tropicalis provides an efficient approach for studying YIF1B function through targeted genetic modifications. The following methodological considerations are important:

Guide RNA Design: When designing guide RNAs targeting the yif1b gene, researchers should:

  • Choose target sites with minimal off-target effects

  • Use inbred X. tropicalis strains to reduce polymorphisms in target regions

  • Target conserved functional domains identified through sequence analysis

Delivery Method: Microinjection of Cas9 protein and guide RNA into one-cell stage embryos is highly effective in Xenopus .

Mosaic Analysis: Since F0 animals show mosaicism, researchers should:

  • Use TIDE analysis to quantify mutation efficiency (can exceed 90% in X. tropicalis)

  • Consider generating F1 animals with germline transmission for stable lines

  • Use tissue-specific promoters to restrict gene editing to relevant cell types

Phenotypic Analysis: For YIF1B studies, researchers should examine:

  • Localization of membrane receptors known to depend on YIF1B for trafficking

  • Neuronal morphology and dendritic arborization

  • Behavioral phenotypes related to serotonergic signaling

What approaches are most effective for detecting and quantifying YIF1B in Xenopus tropicalis samples?

Several complementary approaches can be used to detect and quantify YIF1B in X. tropicalis:

Western Blotting: Many antibodies developed against X. laevis proteins cross-react with X. tropicalis proteins . For YIF1B detection:

  • Use antibodies against conserved epitopes

  • Include appropriate positive controls

  • Quantify band intensity using standard curve methods

Immunohistochemistry/Immunofluorescence: These techniques allow visualization of YIF1B in tissue sections or whole-mount preparations:

  • X. laevis immunohistochemistry protocols work effectively for X. tropicalis without modification

  • Counterstain with markers for subcellular compartments to determine localization

RT-qPCR: For quantifying yif1b mRNA expression:

  • Design primers specific to X. tropicalis yif1b sequence

  • Normalize to established X. tropicalis housekeeping genes

  • Compare expression across tissues and developmental stages

RNA-Seq: For genome-wide expression analysis, RNA-seq can provide comprehensive data on yif1b expression patterns:

  • Use established protocols for X. tropicalis transcriptome analysis

  • Calculate TPM (transcripts per million reads) for relative abundance quantification

  • Perform differential expression analysis across tissues or conditions

How does YIF1B function compare between Xenopus tropicalis and mammalian systems?

Comparative studies between X. tropicalis YIF1B and mammalian orthologs can provide evolutionary insights into receptor trafficking mechanisms. The interaction between YIF1B and the 5-HT1A receptor has been demonstrated in rat brain, suggesting functional conservation across vertebrate species .

The amino acid sequence of X. tropicalis YIF1B shows significant similarity to mammalian orthologs, reflecting evolutionary conservation of this protein's function in intracellular trafficking . This conservation suggests that findings from X. tropicalis studies likely have relevance to mammalian systems, including humans.

For comprehensive comparative analysis, researchers should:

  • Perform phylogenetic analysis of YIF1B sequences across vertebrate species

  • Test whether X. tropicalis YIF1B can functionally substitute for mammalian orthologs in rescue experiments

  • Compare interaction partners identified in X. tropicalis with those known in mammalian systems

  • Determine if trafficking defects observed in X. tropicalis YIF1B mutants are mirrored in mammalian models

What advantages does Xenopus tropicalis offer for studying YIF1B compared to other model organisms?

X. tropicalis offers several distinct advantages for YIF1B research compared to other model systems:

Genetic Tractability: Unlike X. laevis, X. tropicalis has a diploid genome enabling more straightforward genetic manipulation and analysis . This feature is particularly valuable for studying the effects of YIF1B mutations.

Developmental Accessibility: External development and large embryo size facilitate microinjection of morpholinos, mRNAs, or CRISPR/Cas9 components . These features allow for easy manipulation of YIF1B expression during development.

Conserved Neuronal Development: X. tropicalis shares conserved neuronal development patterns with mammals while offering experimental advantages such as accessibility and rapid development.

Established Molecular Toolkit: Many analytical reagents developed for X. laevis work effectively in X. tropicalis , providing a rich set of tools for YIF1B research without the need to develop species-specific reagents.

Inbred Strains: The availability of inbred X. tropicalis strains with reduced genetic variability improves the consistency and reproducibility of genetic experiments .

How can transcriptomic analysis enhance our understanding of YIF1B function in Xenopus tropicalis?

Transcriptomic analysis can provide valuable insights into YIF1B function in X. tropicalis through several approaches:

Expression Profiling: RNA-seq analysis can identify tissues and developmental stages with high yif1b expression, suggesting where its function is most critical . This approach can also reveal potential co-regulated genes that may function in the same pathway.

Differential Expression Analysis: Comparing transcriptomes between wild-type and YIF1B-deficient X. tropicalis can identify downstream genes affected by YIF1B dysfunction . Such analysis requires:

  • Stringent criteria for defining differential expression (≥2-fold changes, FDR <0.05)

  • TPM (transcripts per million reads) calculation for accurate abundance estimation

  • Proper biological replicates to ensure statistical validity

Gene Ontology Analysis: Functional categorization of differentially expressed genes can reveal biological processes affected by YIF1B manipulation . This approach has been successfully applied in X. tropicalis transcriptome studies.

Comparative Transcriptomics: Comparing transcriptomic changes in YIF1B-deficient X. tropicalis with those reported in mammalian models can establish evolutionary conservation of YIF1B-dependent pathways.

How can researchers overcome common challenges when working with Recombinant Xenopus tropicalis YIF1B protein?

Working with recombinant YIF1B protein can present several challenges. Here are methodological approaches to address common issues:

Protein Solubility: YIF1B contains transmembrane domains that may affect solubility . Researchers can:

  • Use mild detergents compatible with membrane proteins (e.g., n-dodecyl-β-D-maltoside)

  • Express truncated versions containing specific domains of interest

  • Optimize buffer conditions (pH, salt concentration, glycerol percentage)

  • Consider fusion tags that enhance solubility (e.g., MBP, SUMO)

Functional Assays: To confirm that recombinant YIF1B retains its native function:

  • Develop in vitro trafficking assays using reconstituted vesicles

  • Test binding to verified interaction partners like 5-HT1A receptor C-terminus

  • Perform rescue experiments in YIF1B-depleted cells

Antibody Cross-Reactivity: When antibodies show non-specific binding:

  • Validate antibodies using YIF1B-knockout samples as negative controls

  • Perform peptide competition assays to confirm specificity

  • Consider generating X. tropicalis-specific antibodies if cross-reactivity is problematic

What methodological considerations are important when designing experiments to study YIF1B-receptor interactions?

When investigating YIF1B interactions with receptors such as 5-HT1A, researchers should consider:

Binding Domain Mapping: To identify specific interaction domains:

  • Generate truncated versions of both YIF1B and receptor C-termini

  • Use site-directed mutagenesis to target conserved residues

  • Employ peptide arrays to pinpoint minimal binding sequences

Interaction Dynamics: To understand the temporal aspects of interactions:

  • Use fluorescence recovery after photobleaching (FRAP) to measure mobility

  • Employ real-time imaging of fluorescently tagged proteins

  • Analyze interaction under various cellular conditions (e.g., ER stress, Golgi disruption)

Specificity Controls: To confirm interaction specificity:

  • Test interactions with related receptor family members

  • Include structural analogs as negative controls

  • Perform competition assays with peptides derived from binding domains

Physiological Relevance: To confirm functional significance:

  • Correlate binding affinity with trafficking efficiency

  • Examine how mutations that disrupt binding affect receptor localization

  • Assess functional output of receptors (signaling) when YIF1B interaction is disrupted

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.