Recombinant Xenopus tropicalis RING finger and transmembrane domain-containing protein 1 (rnft1)

Shipped with Ice Packs
In Stock

Description

Protein Sequence and Basic Properties

The rnft1 protein from Xenopus tropicalis is a full-length protein consisting of 416 amino acids. It is cataloged in the UniProt database with the accession number Q28GL3 . The complete amino acid sequence reveals characteristic motifs consistent with both transmembrane regions and the RING finger domain that gives the protein its name.

The complete amino acid sequence of rnft1 is as follows:
"MKHRPVHERQCSTETKNWKENTQLIMQSSSGHTHHQPGSNDSPSVCMSLPVPQLSAEGSCTAGDVTIDLSSPESHHGARSSSRRVRPGNGRSLSRHGHTHSHDANGPEDANDADSREQSNSISEVFHFYKWLEKSFPYILIFSAKLVVQHITGISVGIGLLTTFLYANKCIVNQVFLRDKCSKLQCLWILVFLLFSSLLLYYTFSSQALYYSLVFMNPSLGPLHFFDALWVVGITDFIGKFFFMGLKCIILLVPSFVMSHKSKGYWYMALEEVAQCYCMLVSTPVWFRYLIDYGNQNSGAEWHFGILLALLYLILKLLIIFGQRKTSSNSLRLFLTQPNYGAAATKSQCSEVDGMCAICQAEFIKPIVLVCQHVFCEECISLWFNKEKTCPLCRTVISNQSHKWKDGATSLQLRIF"

Table 1: Key Properties of Xenopus tropicalis rnft1

PropertyDescription
Recommended NameRING finger and transmembrane domain-containing protein 1
Gene Namernft1
ORF NameTEgg046i15.1
UniProt AccessionQ28GL3
SpeciesXenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Expression Region1-416
Sequence InfoFull length protein

Domain Organization

The RING finger domain is a specialized zinc finger structure characterized by a distinct pattern of cysteine and histidine residues that coordinate zinc ions. This domain is typically associated with E3 ubiquitin ligase activity, suggesting a potential role in protein degradation pathways. The C-terminal region of the protein contains the sequence "MCAICQAEFIKPIVLVCQHVFCEECISLWFNKEKTCPLCRTVISNQSHKWKDGATSLQLRIF," which includes the characteristic cysteine-rich pattern typical of RING domains .

The transmembrane domains in rnft1 likely span the lipid bilayer of cellular membranes, anchoring the protein and potentially facilitating membrane-associated signaling or transport functions. The presence of hydrophobic amino acid stretches in the sequence, such as "LVVQHITGISVGIGLLTTFLYANKCIVNQVFLRDK," suggests regions that could serve as membrane-spanning domains .

Functional Aspects of rnft1

The specific cellular functions of rnft1 in Xenopus tropicalis remain to be fully characterized, but its domain architecture provides insight into potential roles.

Potential Molecular Functions

Based on its domain structure, rnft1 likely serves multiple functions within cells:

  1. Protein Ubiquitination: The RING finger domain strongly suggests that rnft1 functions as an E3 ubiquitin ligase, potentially targeting specific proteins for degradation by the proteasome. This activity would implicate rnft1 in protein quality control and regulatory processes that depend on selective protein turnover.

  2. Membrane-Associated Signaling: As a transmembrane protein, rnft1 may participate in signal transduction pathways that transmit information across cellular membranes. The protein could serve as a receptor or adapter molecule that connects extracellular signals to intracellular responses.

  3. Protein-Protein Interactions: RING domains mediate interactions with other proteins, suggesting that rnft1 may function as part of larger protein complexes involved in cellular processes such as development, differentiation, or stress responses.

Transcriptome Analysis in Xenopus tropicalis

While the search results do not provide specific information about rnft1 expression patterns, comprehensive RNA sequencing studies of Xenopus tropicalis development have been conducted across 23 distinct developmental stages. These studies have shown that despite general transcriptional silence in early development, approximately 150 genes are transcribed prior to the midblastula transition, potentially including rnft1 .

The temporal expression of genes like rnft1 could be critical for understanding their developmental roles. The comprehensive transcriptome analysis of Xenopus tropicalis has revealed more than 10,000 novel splice junctions at each developmental stage, suggesting complex regulation of gene expression during embryogenesis .

Genomic Context

Xenopus tropicalis has emerged as an important model organism for developmental biology research. Its genome contains 1235 genes encoding DNA-binding transcription factors, comparable to the numbers found in typical mammalian species. The repertoire of transcription factor genes is nearly identical to human and mouse, with the exception of zinc finger family members and a small number of species-specific gene duplications and losses .

While rnft1 itself is not identified as a transcription factor in the search results, understanding its genomic context within Xenopus tropicalis provides valuable insight into its potential evolutionary conservation and functional significance.

Properties of Recombinant rnft1

Recombinant Xenopus tropicalis rnft1 is available as a research tool for applications such as ELISA (Enzyme-Linked Immunosorbent Assay). The following table summarizes the key properties of commercially available recombinant rnft1 :

Table 2: Properties of Recombinant Xenopus tropicalis rnft1

PropertySpecification
Quantity50 μg (other quantities available)
Product TypeRecombinant Protein
Tag InformationDetermined during production process
Storage BufferTris-based buffer, 50% glycerol, optimized for this protein
Storage ConditionsStore at -20°C; for extended storage, conserve at -20°C or -80°C
Handling NotesRepeated freezing and thawing not recommended; store working aliquots at 4°C for up to one week

Research Applications

Recombinant rnft1 protein serves various research purposes:

  1. Structural Studies: Purified recombinant rnft1 can be used for structural analyses to determine its three-dimensional conformation, providing insights into its functional mechanisms.

  2. Protein Interaction Studies: The recombinant protein can be employed in pull-down assays, co-immunoprecipitation experiments, or yeast two-hybrid screens to identify binding partners, thereby elucidating its participation in protein complexes and signaling pathways.

  3. Antibody Production: Recombinant rnft1 can serve as an antigen for generating antibodies, which are valuable tools for studying protein localization, expression levels, and functional analyses in vivo.

  4. Enzymatic Assays: If rnft1 functions as an E3 ubiquitin ligase as suggested by its RING domain, recombinant protein can be used in in vitro ubiquitination assays to identify potential substrates and characterize its enzymatic activity.

Advantages of Xenopus as a Research Model

Xenopus tropicalis offers several advantages for studying proteins like rnft1:

  1. Developmental Accessibility: Xenopus embryos develop externally and are relatively large, making them amenable to experimental manipulations and observations throughout development.

  2. Genetic Manipulability: Modern genome editing technologies can be applied to Xenopus tropicalis to create gene knockouts or modifications for functional studies of rnft1.

  3. Evolutionary Insights: As a vertebrate model with substantial genomic conservation with mammals, studies of rnft1 in Xenopus tropicalis may provide insights relevant to understanding its homologs in humans and other mammals.

Gene Regulatory Networks

Studies have been conducted to infer gene regulatory networks in Xenopus tropicalis embryos, particularly focusing on the establishment of the three germ layers (ectoderm, mesoderm, and endoderm) during early development . While rnft1 is not specifically mentioned in these regulatory networks in the search results, such frameworks provide context for understanding how proteins like rnft1 might function within larger developmental programs.

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery details.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
rnft1; TEgg046i15.1; E3 ubiquitin-protein ligase RNFT1; RING finger and transmembrane domain-containing protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-416
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
rnft1
Target Protein Sequence
MKHRPVHERQCSTETKNWKENTQLIMQSSSGHTHHQPGSNDSPSVCMSLPVPQLSAEGSC TAGDVTIDLSSPESHHGARSSSRRVRPGNGRSLSRHGHTHSHDANGPEDANDADSREQSN SISEVFHFYKWLEKSFPYILIFSAKLVVQHITGISVGIGLLTTFLYANKCIVNQVFLRDK CSKLQCLWILVFLLFSSLLLYYTFSSQALYYSLVFMNPSLGPLHFFDALWVVGITDFIGK FFFMGLKCIILLVPSFVMSHKSKGYWYMALEEVAQCYCMLVSTPVWFRYLIDYGNQNSGA EWHFGILLALLYLILKLLIIFGQRKTSSNSLRLFLTQPNYGAAATKSQCSEVDGMCAICQ AEFIKPIVLVCQHVFCEECISLWFNKEKTCPLCRTVISNQSHKWKDGATSLQLRIF
Uniprot No.

Target Background

Function
Recombinant Xenopus tropicalis RING finger and transmembrane domain-containing protein 1 (rnft1) is an E3 ubiquitin-protein ligase that plays a critical role in the endoplasmic reticulum (ER)-associated degradation (ERAD) pathway. This pathway targets misfolded proteins that accumulate in the ER for ubiquitination, ultimately leading to their degradation by the proteasome. rnft1 helps protect cells from ER stress-induced apoptosis.
Database Links

KEGG: xtr:549103

UniGene: Str.9619

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of rnft1 in Xenopus tropicalis?

Xenopus tropicalis rnft1 represents one of many genes characterized in this diploid amphibian model organism. Unlike the pseudotetraploid Xenopus laevis, X. tropicalis offers significant advantages for genomic analysis with its simpler diploid genome . The rnft1 gene, like other protein-coding genes in X. tropicalis, would be expected to follow the classical gene architecture with exons and introns.

To determine the precise genomic organization of rnft1:

  • Reference the X. tropicalis genome assembly and annotation in public databases

  • Amplify the complete rnft1 gene sequence using PCR with primers designed to flank the predicted coding region

  • Compare the structure with orthologs in other vertebrate species

  • Analyze intron-exon boundaries to identify conserved regions

This approach parallels methods used for characterizing other X. tropicalis genes, such as the endogenous retrovirus XTERV1, where researchers confirmed genomic sequences by amplifying fragments from genomic DNA extracted from different X. tropicalis populations .

How is rnft1 expression regulated during Xenopus tropicalis development?

Regulation of gene expression during X. tropicalis development often involves complex temporal and spatial patterns. Based on studies of other X. tropicalis genes, rnft1 expression might be regulated by:

  • Transcription factors (possibly T-box factors like VegT that regulate Xnr1)

  • Autoregulatory loops similar to those observed for Xnr1

  • Specific promoter elements containing binding sites for developmental regulators

  • Tissue-specific enhancers that direct expression in particular cell types

To investigate rnft1 expression regulation:

  • Perform quantitative PCR (qPCR) at different developmental stages using reference genes like ornithine decarboxylase 1 (odc1) or ribosomal protein L8 (rpl8) for normalization

  • Use the comparative threshold cycle (CT) method to determine relative gene abundance

  • Generate transgenic embryos with rnft1 promoter-reporter constructs to visualize expression patterns

  • Conduct mutation analysis of potential regulatory elements in the promoter

This approach leverages the established transgenic methods now available for X. tropicalis, which allow for detailed study of late development and organogenesis .

What are the structural features of Xenopus tropicalis rnft1 protein?

The rnft1 protein in X. tropicalis is characterized by two key domains:

  • RING finger domain:

    • A zinc finger domain containing a C3HC4 amino acid motif that binds two zinc ions

    • Typically involved in mediating protein-protein interactions and often associated with E3 ubiquitin ligase activity

    • Likely adopts a cross-brace structure similar to other RING domains

  • Transmembrane domain:

    • Hydrophobic region that anchors the protein within cellular membranes

    • May determine subcellular localization to specific organelles (e.g., ER, Golgi, plasma membrane)

To characterize these structural features:

  • Perform sequence alignment with rnft1 orthologs from other species

  • Use bioinformatic tools to predict domain boundaries and secondary structures

  • Express recombinant portions of the protein for structural studies

  • Generate tagged versions for cellular localization studies

Similar domain characterization approaches have been applied to other X. tropicalis proteins, with attention to functional motifs that are evolutionarily conserved .

What technical challenges arise when expressing recombinant X. tropicalis rnft1 in heterologous systems?

Expressing X. tropicalis rnft1 in heterologous expression systems presents several challenges:

  • Transmembrane domain solubility issues:

    • The hydrophobic transmembrane region can cause protein aggregation

    • Solution: Express soluble domains separately or use specialized detergents during purification

    • Alternative: Employ membrane-mimetic systems like nanodiscs or liposomes

  • Proper folding of the RING finger domain:

    • Zinc coordination is essential for proper folding

    • Solution: Supplement expression medium with zinc and include reducing agents during purification

    • Validate folding using circular dichroism or zinc-binding assays

  • Post-translational modifications:

    • X. tropicalis proteins may require specific modifications absent in bacterial systems

    • Solution: Use eukaryotic expression systems (insect cells, mammalian cells) that provide appropriate modification machinery

    • Verify modifications by mass spectrometry

  • Expression optimization protocol:

    • Clone the X. tropicalis rnft1 cDNA into appropriate expression vectors

    • Test expression in multiple systems (E. coli, insect cells, mammalian cells)

    • Optimize induction conditions (temperature, time, inducer concentration)

    • Include affinity tags for purification while ensuring tag position doesn't interfere with function

These approaches parallel methodologies used for other challenging membrane proteins from X. tropicalis, adapting established protocols to address the specific requirements of rnft1.

How can gene set analysis be optimized for studying rnft1-associated pathways in X. tropicalis?

Gene set analysis for rnft1-associated pathways in X. tropicalis requires careful methodological considerations:

  • Selection of appropriate gene set analysis method:

    • Over-Representation Analysis (ORA) methods identify statistically over-represented gene sets but rely on gene-gene independence assumptions that are biologically invalid

    • Functional Class Scoring (FCS) methods can detect concordant signals from genes within a gene set that might be missed by threshold-based methods

    • Topology-based methods incorporate pathway structure information but may suffer from low specificity

  • Addressing key challenges in gene set analysis:

    • Gene set overlap: rnft1 may participate in multiple pathways, causing overlapping gene sets that need to be properly addressed to avoid false positives

    • Lack of gold standard datasets: Validate results using multiple methodologies to compensate for the absence of ground truth

    • Expression data heterogeneity: Account for non-normal distribution of gene expression data in X. tropicalis samples

  • X. tropicalis-specific considerations:

    • Utilize X. tropicalis-specific microarrays or RNA-seq platforms for genome-wide expression analysis

    • Compare expression profiles across different developmental stages and tissues

    • Integrate results with existing X. tropicalis expression databases

  • Implementation workflow:

    • Generate expression data from relevant X. tropicalis tissues or developmental stages

    • Pre-process data to account for technical variations

    • Apply multiple gene set analysis methods and compare results

    • Validate key findings using independent experimental approaches

This methodology integrates the advantages of X. tropicalis as a model organism with advanced bioinformatic approaches to provide a comprehensive understanding of rnft1-associated pathways.

What are the functional consequences of rnft1 knockdown or overexpression during X. tropicalis development?

Investigating the functional role of rnft1 through gain and loss-of-function studies requires:

  • Loss-of-function approaches:

    • Morpholino oligonucleotides targeted to rnft1 mRNA splicing or translation start sites

    • CRISPR/Cas9-mediated gene editing to generate rnft1 knockout lines

    • Dominant-negative constructs expressing catalytically inactive RING domain variants

  • Gain-of-function approaches:

    • mRNA microinjection for temporal overexpression

    • Transgenic expression using tissue-specific promoters

    • Inducible expression systems for stage-specific activation

  • Phenotypic analysis methodology:

    • Morphological assessment at key developmental stages

    • Histological examination of affected tissues

    • Molecular marker analysis for changes in developmental pathways

    • Transcriptomic profiling to identify affected downstream genes

  • Phenotype validation and rescue experiments:

    • Rescue morphant or mutant phenotypes with wild-type rnft1 mRNA

    • Structure-function analysis using domain-specific mutations

    • Cross-species rescue to test functional conservation

These functional approaches leverage the well-established microinjection and transgenic techniques available for X. tropicalis, similar to methodologies used to study the regulation of early expression of Xenopus nodal-related genes .

How can X. tropicalis rnft1 protein-protein interactions be comprehensively mapped?

Mapping the protein interaction network of X. tropicalis rnft1 requires a multi-faceted approach:

  • In vitro interaction studies:

    • Yeast two-hybrid screening using the RING finger domain as bait

    • GST pull-down assays with recombinant rnft1 domains

    • Surface plasmon resonance to determine binding kinetics

    • In vitro ubiquitination assays to identify potential substrates

  • In vivo interaction mapping:

    • Co-immunoprecipitation from X. tropicalis tissues or embryos

    • Proximity labeling approaches (BioID or APEX) with rnft1 as the bait protein

    • FRET or BiFC assays to validate direct interactions in living cells

    • Crosslinking mass spectrometry to capture transient interactions

  • Bioinformatic prediction and validation:

    • Interolog mapping based on known interactions of rnft1 orthologs

    • Structural modeling to predict interaction interfaces

    • Integration with X. tropicalis transcriptome data to identify co-expressed genes

  • Experimental validation protocol:

    TechniqueAdvantagesLimitationsControls Required
    Co-IPDetects native interactionsMay miss weak interactionsIgG control, Input sample
    Y2HHigh-throughput screeningHigh false positive rateAutoactivation controls
    Pull-downDirect binding assessmentNon-physiological conditionsGST-only control
    BioIDDetects proximal proteinsRequires fusion protein expressionBirA* only control

This systematic approach provides a comprehensive view of rnft1's interaction network, offering insights into its functional roles during X. tropicalis development and cellular processes.

What are the optimal conditions for expressing and purifying recombinant X. tropicalis rnft1?

The optimal conditions for recombinant X. tropicalis rnft1 expression and purification involve:

  • Expression system selection:

    • E. coli: Suitable for soluble domains (RING finger domain alone)

    • Insect cells: Better for full-length protein including transmembrane domain

    • Mammalian cells: Optimal for maintaining native post-translational modifications

  • Expression vector design:

    • Include fusion tags (His, GST, MBP) for enhanced solubility and purification

    • Incorporate cleavage sites for tag removal

    • Consider codon optimization for the expression host

  • Optimized purification protocol:

    • Cell lysis: Detergent selection crucial for membrane protein extraction (CHAPS, DDM, or Triton X-100)

    • Initial capture: Affinity chromatography using tag-specific resins

    • Intermediate purification: Ion exchange chromatography

    • Final polishing: Size exclusion chromatography

  • Quality control assessments:

    • SDS-PAGE for purity and integrity

    • Western blotting for identity confirmation

    • Mass spectrometry for accurate mass determination

    • Circular dichroism for secondary structure confirmation

    • Dynamic light scattering for homogeneity assessment

Researchers should establish protein stability conditions through systematic screening of buffers, pH, salt concentrations, and additives to maintain the functional integrity of the purified rnft1 protein.

How can microarray and RNA-seq data be leveraged to study X. tropicalis rnft1 expression networks?

Leveraging genomic technologies for studying rnft1 expression networks requires sophisticated methodology:

  • Experimental design considerations:

    • Tissue specificity: Compare expression across multiple X. tropicalis tissues

    • Developmental trajectory: Sample key developmental stages

    • Perturbation responses: Analyze effects of rnft1 knockdown/overexpression

  • Data generation and processing:

    • For microarrays: Use X. tropicalis-specific arrays with appropriate controls

    • For RNA-seq: Generate high-depth sequencing with sufficient biological replicates

    • Quality control: Filter low-quality reads and normalize expression data

    • Differential expression analysis: Apply appropriate statistical methods with multiple testing correction

  • Network reconstruction approaches:

    • Co-expression network analysis: Weighted gene correlation network analysis (WGCNA)

    • Causal inference: Bayesian network reconstruction

    • Integration with prior knowledge: Incorporate known interactions and pathway information

  • Validation experiments:

    • qRT-PCR confirmation of key differentially expressed genes

    • In situ hybridization to validate spatial expression patterns

    • Reporter assays to confirm direct regulatory relationships

These approaches have been successfully applied to study temporal and spatial gene expression in X. tropicalis, as demonstrated by microarray studies that identified novel temporally regulated, spatially restricted genes during early development .

How does X. tropicalis rnft1 compare structurally and functionally to its orthologs in other vertebrates?

Comparative analysis of X. tropicalis rnft1 with orthologs from other vertebrates provides evolutionary insights:

  • Sequence conservation analysis:

    • Multiple sequence alignment of rnft1 proteins from fish, amphibians, reptiles, birds, and mammals

    • Identification of highly conserved residues within the RING finger and transmembrane domains

    • Detection of species-specific adaptations or innovations

  • Structural conservation assessment:

    • Prediction of secondary and tertiary structures across species

    • Comparison of domain architecture and organization

    • Identification of conserved structural motifs critical for function

  • Functional conservation evaluation:

    • Cross-species complementation experiments in model systems

    • Analysis of conserved interaction partners across vertebrates

    • Comparison of expression patterns during development

  • Evolutionary rate analysis:

    • Calculation of synonymous and non-synonymous substitution rates

    • Detection of positive or purifying selection on specific domains

    • Reconstruction of the evolutionary history of rnft1 in vertebrates

This comparative approach leverages the advantages of X. tropicalis as a tetrapod model with a diploid genome, offering a bridge between mammalian and fish models in evolutionary studies .

What can X. tropicalis rnft1 research tell us about the evolution of E3 ubiquitin ligases?

The study of X. tropicalis rnft1 provides valuable evolutionary insights into E3 ubiquitin ligases:

  • Phylogenetic analysis of RING-type E3 ligases:

    • Construct comprehensive phylogenetic trees of RING domain-containing proteins

    • Determine the evolutionary relationship between rnft1 and other E3 ligases

    • Identify ancestral RING finger proteins and trace diversification events

  • Functional evolution assessment:

    • Compare substrate specificity across evolutionary lineages

    • Analyze co-evolution with interacting partners

    • Examine expansion or contraction of RING ligase families in different vertebrate lineages

  • Domain architecture evolution:

    • Track the acquisition or loss of functional domains during evolution

    • Analyze the innovation of the transmembrane domain in rnft1-like proteins

    • Identify recombination events that may have created novel domain combinations

  • Regulatory evolution:

    • Compare expression patterns and tissue specificity across species

    • Analyze promoter evolution to identify conserved and divergent regulatory elements

    • Investigate the evolution of post-translational regulation mechanisms

X. tropicalis, with its position in vertebrate phylogeny and experimental tractability, provides an excellent model for these evolutionary studies, offering advantages similar to those that have made it valuable for developmental biology research .

What are the future research directions for X. tropicalis rnft1 studies?

Future research on X. tropicalis rnft1 should address several promising directions:

  • Comprehensive functional characterization:

    • Generate rnft1 knockout X. tropicalis lines using CRISPR/Cas9

    • Perform detailed phenotypic analysis throughout development

    • Conduct tissue-specific conditional knockout studies

  • Integration with emerging technologies:

    • Apply single-cell RNA-seq to map rnft1 expression at cellular resolution

    • Utilize proteomics to identify the full range of rnft1 substrates

    • Implement CRISPR screens to identify genetic interactors

  • Translational research applications:

    • Explore the relevance of findings to human disease models

    • Investigate potential conservation of rnft1 function in disease pathways

    • Develop therapeutic strategies based on modulating rnft1 activity

  • Methodology development:

    • Establish improved heterologous expression systems for membrane proteins

    • Develop more sensitive assays for E3 ligase activity

    • Create better computational tools for predicting substrate recognition

These future directions build upon the established advantages of X. tropicalis as a model organism, including its diploid genome, efficient transgenic methods, and similarity to human genes , while addressing the specific challenges of studying transmembrane RING finger proteins in developmental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.