The rnft1 protein from Xenopus tropicalis is a full-length protein consisting of 416 amino acids. It is cataloged in the UniProt database with the accession number Q28GL3 . The complete amino acid sequence reveals characteristic motifs consistent with both transmembrane regions and the RING finger domain that gives the protein its name.
The complete amino acid sequence of rnft1 is as follows:
"MKHRPVHERQCSTETKNWKENTQLIMQSSSGHTHHQPGSNDSPSVCMSLPVPQLSAEGSCTAGDVTIDLSSPESHHGARSSSRRVRPGNGRSLSRHGHTHSHDANGPEDANDADSREQSNSISEVFHFYKWLEKSFPYILIFSAKLVVQHITGISVGIGLLTTFLYANKCIVNQVFLRDKCSKLQCLWILVFLLFSSLLLYYTFSSQALYYSLVFMNPSLGPLHFFDALWVVGITDFIGKFFFMGLKCIILLVPSFVMSHKSKGYWYMALEEVAQCYCMLVSTPVWFRYLIDYGNQNSGAEWHFGILLALLYLILKLLIIFGQRKTSSNSLRLFLTQPNYGAAATKSQCSEVDGMCAICQAEFIKPIVLVCQHVFCEECISLWFNKEKTCPLCRTVISNQSHKWKDGATSLQLRIF"
Table 1: Key Properties of Xenopus tropicalis rnft1
| Property | Description |
|---|---|
| Recommended Name | RING finger and transmembrane domain-containing protein 1 |
| Gene Name | rnft1 |
| ORF Name | TEgg046i15.1 |
| UniProt Accession | Q28GL3 |
| Species | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Expression Region | 1-416 |
| Sequence Info | Full length protein |
The RING finger domain is a specialized zinc finger structure characterized by a distinct pattern of cysteine and histidine residues that coordinate zinc ions. This domain is typically associated with E3 ubiquitin ligase activity, suggesting a potential role in protein degradation pathways. The C-terminal region of the protein contains the sequence "MCAICQAEFIKPIVLVCQHVFCEECISLWFNKEKTCPLCRTVISNQSHKWKDGATSLQLRIF," which includes the characteristic cysteine-rich pattern typical of RING domains .
The transmembrane domains in rnft1 likely span the lipid bilayer of cellular membranes, anchoring the protein and potentially facilitating membrane-associated signaling or transport functions. The presence of hydrophobic amino acid stretches in the sequence, such as "LVVQHITGISVGIGLLTTFLYANKCIVNQVFLRDK," suggests regions that could serve as membrane-spanning domains .
The specific cellular functions of rnft1 in Xenopus tropicalis remain to be fully characterized, but its domain architecture provides insight into potential roles.
Based on its domain structure, rnft1 likely serves multiple functions within cells:
Protein Ubiquitination: The RING finger domain strongly suggests that rnft1 functions as an E3 ubiquitin ligase, potentially targeting specific proteins for degradation by the proteasome. This activity would implicate rnft1 in protein quality control and regulatory processes that depend on selective protein turnover.
Membrane-Associated Signaling: As a transmembrane protein, rnft1 may participate in signal transduction pathways that transmit information across cellular membranes. The protein could serve as a receptor or adapter molecule that connects extracellular signals to intracellular responses.
Protein-Protein Interactions: RING domains mediate interactions with other proteins, suggesting that rnft1 may function as part of larger protein complexes involved in cellular processes such as development, differentiation, or stress responses.
While the search results do not provide specific information about rnft1 expression patterns, comprehensive RNA sequencing studies of Xenopus tropicalis development have been conducted across 23 distinct developmental stages. These studies have shown that despite general transcriptional silence in early development, approximately 150 genes are transcribed prior to the midblastula transition, potentially including rnft1 .
The temporal expression of genes like rnft1 could be critical for understanding their developmental roles. The comprehensive transcriptome analysis of Xenopus tropicalis has revealed more than 10,000 novel splice junctions at each developmental stage, suggesting complex regulation of gene expression during embryogenesis .
Xenopus tropicalis has emerged as an important model organism for developmental biology research. Its genome contains 1235 genes encoding DNA-binding transcription factors, comparable to the numbers found in typical mammalian species. The repertoire of transcription factor genes is nearly identical to human and mouse, with the exception of zinc finger family members and a small number of species-specific gene duplications and losses .
While rnft1 itself is not identified as a transcription factor in the search results, understanding its genomic context within Xenopus tropicalis provides valuable insight into its potential evolutionary conservation and functional significance.
Recombinant Xenopus tropicalis rnft1 is available as a research tool for applications such as ELISA (Enzyme-Linked Immunosorbent Assay). The following table summarizes the key properties of commercially available recombinant rnft1 :
Table 2: Properties of Recombinant Xenopus tropicalis rnft1
| Property | Specification |
|---|---|
| Quantity | 50 μg (other quantities available) |
| Product Type | Recombinant Protein |
| Tag Information | Determined during production process |
| Storage Buffer | Tris-based buffer, 50% glycerol, optimized for this protein |
| Storage Conditions | Store at -20°C; for extended storage, conserve at -20°C or -80°C |
| Handling Notes | Repeated freezing and thawing not recommended; store working aliquots at 4°C for up to one week |
Recombinant rnft1 protein serves various research purposes:
Structural Studies: Purified recombinant rnft1 can be used for structural analyses to determine its three-dimensional conformation, providing insights into its functional mechanisms.
Protein Interaction Studies: The recombinant protein can be employed in pull-down assays, co-immunoprecipitation experiments, or yeast two-hybrid screens to identify binding partners, thereby elucidating its participation in protein complexes and signaling pathways.
Antibody Production: Recombinant rnft1 can serve as an antigen for generating antibodies, which are valuable tools for studying protein localization, expression levels, and functional analyses in vivo.
Enzymatic Assays: If rnft1 functions as an E3 ubiquitin ligase as suggested by its RING domain, recombinant protein can be used in in vitro ubiquitination assays to identify potential substrates and characterize its enzymatic activity.
Xenopus tropicalis offers several advantages for studying proteins like rnft1:
Developmental Accessibility: Xenopus embryos develop externally and are relatively large, making them amenable to experimental manipulations and observations throughout development.
Genetic Manipulability: Modern genome editing technologies can be applied to Xenopus tropicalis to create gene knockouts or modifications for functional studies of rnft1.
Evolutionary Insights: As a vertebrate model with substantial genomic conservation with mammals, studies of rnft1 in Xenopus tropicalis may provide insights relevant to understanding its homologs in humans and other mammals.
Studies have been conducted to infer gene regulatory networks in Xenopus tropicalis embryos, particularly focusing on the establishment of the three germ layers (ectoderm, mesoderm, and endoderm) during early development . While rnft1 is not specifically mentioned in these regulatory networks in the search results, such frameworks provide context for understanding how proteins like rnft1 might function within larger developmental programs.
KEGG: xtr:549103
UniGene: Str.9619
Xenopus tropicalis rnft1 represents one of many genes characterized in this diploid amphibian model organism. Unlike the pseudotetraploid Xenopus laevis, X. tropicalis offers significant advantages for genomic analysis with its simpler diploid genome . The rnft1 gene, like other protein-coding genes in X. tropicalis, would be expected to follow the classical gene architecture with exons and introns.
To determine the precise genomic organization of rnft1:
Reference the X. tropicalis genome assembly and annotation in public databases
Amplify the complete rnft1 gene sequence using PCR with primers designed to flank the predicted coding region
Compare the structure with orthologs in other vertebrate species
Analyze intron-exon boundaries to identify conserved regions
This approach parallels methods used for characterizing other X. tropicalis genes, such as the endogenous retrovirus XTERV1, where researchers confirmed genomic sequences by amplifying fragments from genomic DNA extracted from different X. tropicalis populations .
Regulation of gene expression during X. tropicalis development often involves complex temporal and spatial patterns. Based on studies of other X. tropicalis genes, rnft1 expression might be regulated by:
Transcription factors (possibly T-box factors like VegT that regulate Xnr1)
Specific promoter elements containing binding sites for developmental regulators
Tissue-specific enhancers that direct expression in particular cell types
To investigate rnft1 expression regulation:
Perform quantitative PCR (qPCR) at different developmental stages using reference genes like ornithine decarboxylase 1 (odc1) or ribosomal protein L8 (rpl8) for normalization
Use the comparative threshold cycle (CT) method to determine relative gene abundance
Generate transgenic embryos with rnft1 promoter-reporter constructs to visualize expression patterns
Conduct mutation analysis of potential regulatory elements in the promoter
This approach leverages the established transgenic methods now available for X. tropicalis, which allow for detailed study of late development and organogenesis .
The rnft1 protein in X. tropicalis is characterized by two key domains:
RING finger domain:
A zinc finger domain containing a C3HC4 amino acid motif that binds two zinc ions
Typically involved in mediating protein-protein interactions and often associated with E3 ubiquitin ligase activity
Likely adopts a cross-brace structure similar to other RING domains
Transmembrane domain:
Hydrophobic region that anchors the protein within cellular membranes
May determine subcellular localization to specific organelles (e.g., ER, Golgi, plasma membrane)
To characterize these structural features:
Perform sequence alignment with rnft1 orthologs from other species
Use bioinformatic tools to predict domain boundaries and secondary structures
Express recombinant portions of the protein for structural studies
Generate tagged versions for cellular localization studies
Similar domain characterization approaches have been applied to other X. tropicalis proteins, with attention to functional motifs that are evolutionarily conserved .
Expressing X. tropicalis rnft1 in heterologous expression systems presents several challenges:
Transmembrane domain solubility issues:
The hydrophobic transmembrane region can cause protein aggregation
Solution: Express soluble domains separately or use specialized detergents during purification
Alternative: Employ membrane-mimetic systems like nanodiscs or liposomes
Proper folding of the RING finger domain:
Zinc coordination is essential for proper folding
Solution: Supplement expression medium with zinc and include reducing agents during purification
Validate folding using circular dichroism or zinc-binding assays
Post-translational modifications:
X. tropicalis proteins may require specific modifications absent in bacterial systems
Solution: Use eukaryotic expression systems (insect cells, mammalian cells) that provide appropriate modification machinery
Verify modifications by mass spectrometry
Expression optimization protocol:
Clone the X. tropicalis rnft1 cDNA into appropriate expression vectors
Test expression in multiple systems (E. coli, insect cells, mammalian cells)
Optimize induction conditions (temperature, time, inducer concentration)
Include affinity tags for purification while ensuring tag position doesn't interfere with function
These approaches parallel methodologies used for other challenging membrane proteins from X. tropicalis, adapting established protocols to address the specific requirements of rnft1.
Gene set analysis for rnft1-associated pathways in X. tropicalis requires careful methodological considerations:
Selection of appropriate gene set analysis method:
Over-Representation Analysis (ORA) methods identify statistically over-represented gene sets but rely on gene-gene independence assumptions that are biologically invalid
Functional Class Scoring (FCS) methods can detect concordant signals from genes within a gene set that might be missed by threshold-based methods
Topology-based methods incorporate pathway structure information but may suffer from low specificity
Addressing key challenges in gene set analysis:
Gene set overlap: rnft1 may participate in multiple pathways, causing overlapping gene sets that need to be properly addressed to avoid false positives
Lack of gold standard datasets: Validate results using multiple methodologies to compensate for the absence of ground truth
Expression data heterogeneity: Account for non-normal distribution of gene expression data in X. tropicalis samples
X. tropicalis-specific considerations:
Implementation workflow:
Generate expression data from relevant X. tropicalis tissues or developmental stages
Pre-process data to account for technical variations
Apply multiple gene set analysis methods and compare results
Validate key findings using independent experimental approaches
This methodology integrates the advantages of X. tropicalis as a model organism with advanced bioinformatic approaches to provide a comprehensive understanding of rnft1-associated pathways.
Investigating the functional role of rnft1 through gain and loss-of-function studies requires:
Loss-of-function approaches:
Morpholino oligonucleotides targeted to rnft1 mRNA splicing or translation start sites
CRISPR/Cas9-mediated gene editing to generate rnft1 knockout lines
Dominant-negative constructs expressing catalytically inactive RING domain variants
Gain-of-function approaches:
mRNA microinjection for temporal overexpression
Transgenic expression using tissue-specific promoters
Inducible expression systems for stage-specific activation
Phenotypic analysis methodology:
Morphological assessment at key developmental stages
Histological examination of affected tissues
Molecular marker analysis for changes in developmental pathways
Transcriptomic profiling to identify affected downstream genes
Phenotype validation and rescue experiments:
Rescue morphant or mutant phenotypes with wild-type rnft1 mRNA
Structure-function analysis using domain-specific mutations
Cross-species rescue to test functional conservation
These functional approaches leverage the well-established microinjection and transgenic techniques available for X. tropicalis, similar to methodologies used to study the regulation of early expression of Xenopus nodal-related genes .
Mapping the protein interaction network of X. tropicalis rnft1 requires a multi-faceted approach:
In vitro interaction studies:
Yeast two-hybrid screening using the RING finger domain as bait
GST pull-down assays with recombinant rnft1 domains
Surface plasmon resonance to determine binding kinetics
In vitro ubiquitination assays to identify potential substrates
In vivo interaction mapping:
Co-immunoprecipitation from X. tropicalis tissues or embryos
Proximity labeling approaches (BioID or APEX) with rnft1 as the bait protein
FRET or BiFC assays to validate direct interactions in living cells
Crosslinking mass spectrometry to capture transient interactions
Bioinformatic prediction and validation:
Interolog mapping based on known interactions of rnft1 orthologs
Structural modeling to predict interaction interfaces
Integration with X. tropicalis transcriptome data to identify co-expressed genes
Experimental validation protocol:
| Technique | Advantages | Limitations | Controls Required |
|---|---|---|---|
| Co-IP | Detects native interactions | May miss weak interactions | IgG control, Input sample |
| Y2H | High-throughput screening | High false positive rate | Autoactivation controls |
| Pull-down | Direct binding assessment | Non-physiological conditions | GST-only control |
| BioID | Detects proximal proteins | Requires fusion protein expression | BirA* only control |
This systematic approach provides a comprehensive view of rnft1's interaction network, offering insights into its functional roles during X. tropicalis development and cellular processes.
The optimal conditions for recombinant X. tropicalis rnft1 expression and purification involve:
Expression system selection:
E. coli: Suitable for soluble domains (RING finger domain alone)
Insect cells: Better for full-length protein including transmembrane domain
Mammalian cells: Optimal for maintaining native post-translational modifications
Expression vector design:
Include fusion tags (His, GST, MBP) for enhanced solubility and purification
Incorporate cleavage sites for tag removal
Consider codon optimization for the expression host
Optimized purification protocol:
Cell lysis: Detergent selection crucial for membrane protein extraction (CHAPS, DDM, or Triton X-100)
Initial capture: Affinity chromatography using tag-specific resins
Intermediate purification: Ion exchange chromatography
Final polishing: Size exclusion chromatography
Quality control assessments:
SDS-PAGE for purity and integrity
Western blotting for identity confirmation
Mass spectrometry for accurate mass determination
Circular dichroism for secondary structure confirmation
Dynamic light scattering for homogeneity assessment
Researchers should establish protein stability conditions through systematic screening of buffers, pH, salt concentrations, and additives to maintain the functional integrity of the purified rnft1 protein.
Leveraging genomic technologies for studying rnft1 expression networks requires sophisticated methodology:
Experimental design considerations:
Tissue specificity: Compare expression across multiple X. tropicalis tissues
Developmental trajectory: Sample key developmental stages
Perturbation responses: Analyze effects of rnft1 knockdown/overexpression
Data generation and processing:
For microarrays: Use X. tropicalis-specific arrays with appropriate controls
For RNA-seq: Generate high-depth sequencing with sufficient biological replicates
Quality control: Filter low-quality reads and normalize expression data
Differential expression analysis: Apply appropriate statistical methods with multiple testing correction
Network reconstruction approaches:
Co-expression network analysis: Weighted gene correlation network analysis (WGCNA)
Causal inference: Bayesian network reconstruction
Integration with prior knowledge: Incorporate known interactions and pathway information
Validation experiments:
qRT-PCR confirmation of key differentially expressed genes
In situ hybridization to validate spatial expression patterns
Reporter assays to confirm direct regulatory relationships
These approaches have been successfully applied to study temporal and spatial gene expression in X. tropicalis, as demonstrated by microarray studies that identified novel temporally regulated, spatially restricted genes during early development .
Comparative analysis of X. tropicalis rnft1 with orthologs from other vertebrates provides evolutionary insights:
Sequence conservation analysis:
Multiple sequence alignment of rnft1 proteins from fish, amphibians, reptiles, birds, and mammals
Identification of highly conserved residues within the RING finger and transmembrane domains
Detection of species-specific adaptations or innovations
Structural conservation assessment:
Prediction of secondary and tertiary structures across species
Comparison of domain architecture and organization
Identification of conserved structural motifs critical for function
Functional conservation evaluation:
Cross-species complementation experiments in model systems
Analysis of conserved interaction partners across vertebrates
Comparison of expression patterns during development
Evolutionary rate analysis:
Calculation of synonymous and non-synonymous substitution rates
Detection of positive or purifying selection on specific domains
Reconstruction of the evolutionary history of rnft1 in vertebrates
This comparative approach leverages the advantages of X. tropicalis as a tetrapod model with a diploid genome, offering a bridge between mammalian and fish models in evolutionary studies .
The study of X. tropicalis rnft1 provides valuable evolutionary insights into E3 ubiquitin ligases:
Phylogenetic analysis of RING-type E3 ligases:
Construct comprehensive phylogenetic trees of RING domain-containing proteins
Determine the evolutionary relationship between rnft1 and other E3 ligases
Identify ancestral RING finger proteins and trace diversification events
Functional evolution assessment:
Compare substrate specificity across evolutionary lineages
Analyze co-evolution with interacting partners
Examine expansion or contraction of RING ligase families in different vertebrate lineages
Domain architecture evolution:
Track the acquisition or loss of functional domains during evolution
Analyze the innovation of the transmembrane domain in rnft1-like proteins
Identify recombination events that may have created novel domain combinations
Regulatory evolution:
Compare expression patterns and tissue specificity across species
Analyze promoter evolution to identify conserved and divergent regulatory elements
Investigate the evolution of post-translational regulation mechanisms
X. tropicalis, with its position in vertebrate phylogeny and experimental tractability, provides an excellent model for these evolutionary studies, offering advantages similar to those that have made it valuable for developmental biology research .
Future research on X. tropicalis rnft1 should address several promising directions:
Comprehensive functional characterization:
Generate rnft1 knockout X. tropicalis lines using CRISPR/Cas9
Perform detailed phenotypic analysis throughout development
Conduct tissue-specific conditional knockout studies
Integration with emerging technologies:
Apply single-cell RNA-seq to map rnft1 expression at cellular resolution
Utilize proteomics to identify the full range of rnft1 substrates
Implement CRISPR screens to identify genetic interactors
Translational research applications:
Explore the relevance of findings to human disease models
Investigate potential conservation of rnft1 function in disease pathways
Develop therapeutic strategies based on modulating rnft1 activity
Methodology development:
Establish improved heterologous expression systems for membrane proteins
Develop more sensitive assays for E3 ligase activity
Create better computational tools for predicting substrate recognition
These future directions build upon the established advantages of X. tropicalis as a model organism, including its diploid genome, efficient transgenic methods, and similarity to human genes , while addressing the specific challenges of studying transmembrane RING finger proteins in developmental contexts.