Recombinant Xenopus tropicalis RING finger protein 170 (rnf170)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Xenopus tropicalis RING finger protein 170 (Rnf170) is a protein that can be purchased for research purposes . It is produced using an in vitro E. coli expression system, ensuring high purity .

Xenopus tropicalis is a species of tropical frog commonly studied in genetics and developmental biology due to its relatively simple genome and ease of manipulation in laboratory settings.

Function and Structure

Rnf170 is an E3 ubiquitin-protein ligase . E3 ubiquitin ligases are enzymes that play a crucial role in the ubiquitination process, which involves attaching ubiquitin molecules to target proteins, thereby marking them for degradation or altering their function. Specifically, RNF170 is involved in the ubiquitination of the inositol 1,4,5-trisphosphate receptor type 1 (ITPR1) .

Role in Disease

Mutations in the RNF170 gene have been associated with hereditary spastic paraplegia (HSP) . HSP is a group of inherited neurological disorders characterized by progressive stiffness and weakness in the legs.

  • Autosomal Recessive HSP: Biallelic mutations in RNF170 have been identified as a likely cause of autosomal recessive HSP . Loss of RNF170 function results in the accumulation of the inositol 1,4,5-trisphosphate receptor (IP3R) .

  • Autosomal Dominant Sensory Ataxia: A specific heterozygous variant (p.Arg199Cys) in RNF170 is associated with autosomal dominant sensory ataxia, which involves degeneration of central sensory tracts .

Research Findings

  • RNF170 and IP3R Regulation: Studies have demonstrated that RNF170 deficiency leads to increased levels of IP3R. In patient-derived fibroblasts and knockout SH-SY5Y neuronal cell lines, loss of RNF170 results in IP3R accumulation, which can be reversed upon RNF170 re-expression .

  • Zebrafish Studies: Knockdown of rnf170 in zebrafish results in neurodevelopmental defects, including microphthalmia (abnormally small eyes), microcephaly (abnormally small head), and loss of motility. These findings are consistent with the expression pattern of rnf170 during development .

  • ERLIN Complex Interaction: The ERLIN complex, composed of ERLIN1 and ERLIN2, scaffolds TMUB1 and RNF170, thereby regulating ERAD pathways controlled by RNF170 .

Genetic Information

  • Gene Symbol: RNF170

  • Aliases: RING finger protein 170

  • NCBI Gene ID: 81790

  • UniProt ID: Q96K19

  • KEGG: xtr:549626

  • STRING: 8364.ENSXETP00000057130

  • UniGene: Str.66518

Mutations and Variants

MutationDescriptionAssociated Phenotype
c.396+3A > GSplice site mutation in RNF170 mRNA, leading to loss of exon 5 and a frameshift Autosomal Recessive HSP
c.304T>C, p.Cys102ArgMissense variant in the RING domain of RNF170 Autosomal Recessive HSP
Exons 4-7 deletionIntragenic deletion of exons 4–7, resulting in loss of the complete RING domain and two transmembrane domains Autosomal Recessive HSP
p.Arg199CysHeterozygous variant associated with sensory ataxia Autosomal Dominant Sensory Ataxia
35-bp frameshiftHomozygous frameshift mutation introduced using CRISPR/Cas9, leading to loss of RNF170 protein expression Increased IP3R-1 levels in SH-SY5Y cells

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please specify this during ordering, and we will prioritize its inclusion.
Synonyms
rnf170; TGas116k14.1; E3 ubiquitin-protein ligase RNF170; RING finger protein 170; RING-type E3 ubiquitin transferase RNF170
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
rnf170
Target Protein Sequence
MADNQEGRPYFPLDEGSIIEGVSDQVIVVVLLSFVAVGSLLYLLLRNDEQNIHPENQDRV RAVREQLQNEQETPPPPRPQFYSDMTCPVCLQQATFPVETNCGHLFCGSCIIAYWRYGSW LGAINCPICRQTVTLIFPLFQATEQEDSQNILREAIGYNRRFSGQPRSLMDRIMDLPTLL RHAFREMFSVGGLFWMFRIRIVLCLLGALFYLVSPLDIIPEAVFGLLGFLDDFFVLFLLL IYISIMYREVVTQRLYR
Uniprot No.

Target Background

Function
Recombinant Xenopus tropicalis RING finger protein 170 (rnf170) is an E3 ubiquitin-protein ligase crucial for stimulus-induced ubiquitination and degradation of inositol 1,4,5-trisphosphate receptors (ITPRs) via the endoplasmic reticulum-associated degradation (ERAD) pathway. It also plays a role in ITPR turnover in unstimulated cells.
Database Links
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the structural composition of Xenopus tropicalis RNF170 protein?

RNF170 in Xenopus tropicalis, similar to other vertebrate homologs, is approximately 257 amino acids in length and highly conserved across species. The protein contains a canonical RING-HC domain and three putative transmembrane domains. Topological analyses indicate that RNF170 resides in the endoplasmic reticulum (ER) membrane with its N-terminus in the ER lumen and both the RING domain and C-terminus positioned in the cytosol . The RING domain is crucial for its ubiquitin ligase activity, with specific zinc-organizing residues (including Cysteine-102) that collectively bind zinc atoms to maintain the rigid structure of the RING core domain .

How conserved is RNF170 between Xenopus tropicalis and other model organisms?

RNF170 is highly conserved across vertebrates, with significant sequence homology between Xenopus tropicalis and other model organisms. Comparative studies show strong conservation in the RING domain and transmembrane regions. For example, when comparing zebrafish rnf170 (which has 266 amino acids) to human and Xenopus homologs, the critical functional domains show >80% sequence identity, particularly in the RING-HC domain and zinc-coordinating residues . This high conservation suggests evolutionary importance of RNF170's function in ER-associated protein degradation pathways across species.

What are the known functional domains of RNF170 and their significance?

RNF170 contains several key functional domains:

DomainPositionFunctionConservation
RING-HC domainCentral regionMediates E3 ubiquitin ligase activity; contains zinc-coordinating residues including Cys102Highly conserved
Transmembrane domainsThree regions throughout proteinAnchors protein to ER membraneHighly conserved
N-terminal domainAmino terminusPositioned in ER lumenModerately conserved
C-terminal domainCarboxy terminusPositioned in cytosol; involved in interaction with substratesModerately conserved

The RING domain is essential for ubiquitin ligase activity, with mutation of key residues such as Cys102 shown to impair ligase activity . The three transmembrane domains anchor RNF170 to the ER membrane, establishing its correct topology for interaction with substrates like IP3 receptors .

What is the expression pattern of rnf170 during Xenopus tropicalis development?

While specific Xenopus tropicalis expression data is limited in the provided search results, we can infer from zebrafish studies that rnf170 likely shows developmental stage-specific expression patterns. In zebrafish at 48 hours post-fertilization (hpf), rnf170 is highly expressed in the brain and to a lesser extent within intersomitic structures of the trunk . This expression pattern correlates with the observed phenotypes when rnf170 is knocked down, suggesting that in Xenopus tropicalis, similar neuro-enriched expression may occur. RT-PCR and in situ hybridization techniques would be appropriate to map the temporal and spatial expression patterns in Xenopus tropicalis embryos and tissues.

How can I effectively detect RNF170 protein localization in Xenopus tropicalis tissues?

For detecting RNF170 localization in Xenopus tropicalis tissues:

  • Immunohistochemistry using antibodies against conserved epitopes of RNF170 is recommended

  • Co-staining with ER markers (e.g., calnexin or PDI) can confirm ER localization

  • For live imaging, expressing fluorescently tagged RNF170 (being careful not to disrupt the transmembrane topology) can reveal dynamic localization

When studying the subcellular localization of RNF170, it's important to note that it's predicted to have its N-terminus in the ER lumen and its RING domain and C-terminus in the cytosol . This topology is critical for its function in mediating the ubiquitination of IP3 receptors.

What is the primary enzymatic function of RNF170 in cellular pathways?

RNF170 functions primarily as an E3 ubiquitin ligase that mediates the ubiquitination and subsequent degradation of inositol 1,4,5-trisphosphate (IP3) receptors via the endoplasmic reticulum-associated degradation (ERAD) pathway . Following IP3 receptor activation, RNF170 associates rapidly with these receptors and facilitates their ubiquitination. The RING domain of RNF170 is essential for this catalytic activity, as demonstrated by studies showing that mutation of key residues (such as Cys101 and His103 in mouse RNF170) abolishes its ubiquitin ligase function . This ubiquitination marks IP3 receptors for proteasomal degradation, serving as a critical regulatory mechanism for calcium signaling homeostasis.

How does RNF170 interact with the IP3 receptor degradation pathway?

RNF170 interacts with the IP3 receptor degradation pathway through the following mechanism:

  • A substantial proportion of RNF170 is constitutively associated with the erlin1/2 (SPFH1/2) complex

  • Upon activation of IP3 receptors, the erlin1/2 complex rapidly binds to these receptors

  • RNF170, through its association with erlin1/2, is brought into proximity with activated IP3 receptors

  • Using its RING domain-mediated E3 ligase activity, RNF170 catalyzes the ubiquitination of IP3 receptors

  • Ubiquitinated IP3 receptors are then processed by the ERAD pathway and degraded by the proteasome

Studies in cell culture have shown that depletion of RNF170 by RNA interference inhibits stimulus-induced IP3 receptor ubiquitination and degradation, while overexpression of catalytically inactive RNF170 mutants suppresses stimulus-induced IP3 receptor processing .

What are the recommended methods for recombinant expression of Xenopus tropicalis RNF170?

For recombinant expression of Xenopus tropicalis RNF170, the following approaches are recommended:

  • Bacterial expression system:

    • Express full-length protein with N-terminal His tag in E. coli (similar to the approach used for zebrafish RNF170)

    • Purify using nickel affinity chromatography

    • Store lyophilized or in buffer with 6% trehalose at -80°C to maintain stability

  • Mammalian expression system:

    • For functional studies, cloning the RNF170 coding sequence into vectors like pcDNA3 is preferable

    • Add epitope tags (e.g., FLAG) to the C-terminus to avoid interference with N-terminal topology

    • Transfect into mammalian cells like HEK293 for protein production

When considering expression systems, it's important to note that RNF170 is a membrane protein with three transmembrane domains, which may present challenges for proper folding in bacterial systems. For functional studies, mammalian expression systems may better preserve the native conformation and post-translational modifications.

What techniques can be used to assess the ubiquitin ligase activity of recombinant RNF170?

The ubiquitin ligase activity of recombinant RNF170 can be assessed using several approaches:

  • In vitro ubiquitination assay:

    • Purified recombinant RNF170

    • E1 and E2 enzymes

    • Ubiquitin (preferably tagged for detection)

    • ATP regeneration system

    • Substrate (e.g., IP3 receptor fragments)

    • Detect ubiquitinated products by Western blot

  • Cell-based assays:

    • Express wildtype or mutant RNF170 in cells

    • Stimulate with carbachol to activate IP3 receptors

    • Monitor IP3 receptor levels over time (0-4 hours post-stimulation)

    • Compare degradation rates between wildtype and knockout/mutant conditions

  • Functional complementation:

    • Use RNF170-knockout cell lines (such as SH-SY5Y(RNF170ko))

    • Rescue with wildtype or mutant RNF170 constructs

    • Measure IP3 receptor levels and degradation kinetics

    • Successful complementation indicates functional ubiquitin ligase activity

Published data shows that in wildtype cells, IP3 receptor levels decrease to approximately 79% of baseline 2 hours after stimulation, while in RNF170-knockout cells, degradation is abolished (levels remain at 107% of baseline) .

How can Xenopus tropicalis be used to model RNF170-associated human diseases?

Xenopus tropicalis can serve as an effective model organism for studying RNF170-associated human diseases through several approaches:

  • Morpholino knockdown: Similar to zebrafish studies, antisense morpholinos can be designed to target intron-exon boundaries of Xenopus tropicalis rnf170 to disrupt normal splicing . This approach allows for temporal control of knockdown and can be verified through RT-PCR.

  • CRISPR/Cas9 gene editing: Generate stable knockout or knock-in lines carrying specific human disease mutations, such as the p.Cys102Arg mutation associated with hereditary spastic paraplegia .

  • mRNA rescue experiments: Inject human wildtype or mutant RNF170 mRNA into rnf170-depleted embryos to assess functional conservation and pathogenicity of variants .

Studies in zebrafish have shown that rnf170 knockdown results in developmental defects by 48 hpf, including microphthalmia, microcephaly, and loss of motility . These phenotypes provide measurable endpoints for assessing the effects of human disease variants in Xenopus tropicalis models.

What are the known pathological mechanisms of RNF170 mutations in neurological disorders?

Mutations in RNF170 have been associated with hereditary spastic paraplegia (HSP) and other neurological disorders through several pathological mechanisms:

  • Impaired IP3 receptor degradation: Loss of RNF170 function leads to accumulation of IP3 receptors, disrupting calcium homeostasis in neurons .

  • Dominant-negative effects: Certain mutations, such as p.Cys102Arg which affects a zinc-coordinating residue in the RING domain, impair ligase activity and may act in a dominant-negative fashion .

  • Disrupted neurogenesis: Studies in zebrafish showed that rnf170 knockdown resulted in reduced neurogenesis in the cranium and aberrant expression of neuronal markers, suggesting RNF170 plays a role in normal neural development .

  • Axonal pathology: In canine models with RNF170 mutations, neuroaxonal dystrophy with swollen axons (spheroids) throughout the central nervous system was observed, similar to human pathology .

The specific phenotypes associated with RNF170 mutations (autosomal recessive spastic paraplegia-85) share similarities with the canine neuroaxonal dystrophy model, suggesting conserved pathological mechanisms across species .

How can I design experiments to investigate the interaction between RNF170 and the erlin1/2 complex in Xenopus tropicalis?

To investigate the interaction between RNF170 and the erlin1/2 complex in Xenopus tropicalis:

  • Co-immunoprecipitation studies:

    • Express tagged versions of RNF170 and erlin1/2 in Xenopus oocytes or embryos

    • Perform immunoprecipitation with anti-tag antibodies

    • Analyze precipitates for presence of interacting partners

    • Compare constitutive vs. stimulus-induced interactions

  • Proximity ligation assays:

    • Use antibodies against RNF170 and erlin1/2

    • Perform PLA in Xenopus tissue sections or cultured cells

    • Quantify interaction signals before and after IP3 receptor stimulation

  • FRET/BRET analysis:

    • Generate fluorescent protein fusions with RNF170 and erlin components

    • Express in Xenopus cells or embryos

    • Measure energy transfer before and after stimulation of IP3 signaling

This investigation is particularly important as research has shown that a substantial proportion of RNF170 is constitutively associated with the erlin1/2 complex, which binds to IP3 receptors immediately after their activation . Understanding the dynamics of this interaction in Xenopus tropicalis could provide insights into the evolutionary conservation of this regulatory mechanism.

What are the current challenges in studying the role of RNF170 in calcium signaling regulation?

The study of RNF170's role in calcium signaling regulation faces several challenges:

  • Variability in experimental responses: Data shows considerable variability in stimulus-dependent IP3R-1 degradation, as evidenced by the fact that changes over time after carbachol stimulation were not statistically significant in some studies (p2h = 0.1722, p4h = 0.7233) .

  • Complex membrane topology: As a triple-pass membrane protein with specific orientation (N-terminus in ER lumen, RING domain in cytosol), maintaining proper topology when creating recombinant constructs is technically challenging .

  • Functional redundancy: Possible compensatory mechanisms by other E3 ligases may mask phenotypes in certain experimental contexts.

  • Temporal dynamics: The rapid and transient nature of RNF170's association with activated IP3 receptors requires high-resolution temporal analysis.

  • Tissue-specific effects: The consequences of RNF170 dysfunction appear to be particularly pronounced in neuronal tissues, suggesting context-dependent functions that may be difficult to study in heterologous systems .

To address these challenges, researchers should consider combining multiple approaches, including electrophysiological measurements of calcium currents, real-time imaging of calcium dynamics, and tissue-specific conditional knockout models.

What therapeutic strategies are being explored for RNF170-associated disorders?

Emerging therapeutic strategies for RNF170-associated disorders include:

  • Gene therapy approaches:

    • Delivery of functional RNF170 using viral vectors

    • CRISPR/Cas9-mediated correction of disease-causing mutations

    • Antisense oligonucleotide therapy to modulate splicing in cases with intronic mutations

  • Pharmacological modulation of calcium signaling:

    • IP3 receptor antagonists to compensate for impaired receptor degradation

    • Calcium channel blockers to normalize disturbed calcium homeostasis

    • Proteasome modulators to enhance degradation of accumulated IP3 receptors

  • Animal model testing:

    • Large animal models, such as the recently identified canine model with RNF170 mutation, offer excellent opportunities for therapeutic trials due to their relatively long lifespan and natural disease progression

    • Xenopus tropicalis models could serve as efficient initial screening systems for these therapeutic approaches

While specific clinical trials for RNF170-related disorders are not mentioned in the search results, the identification of animal models with long lifespans, such as the canine model, represents an important step toward therapeutic development .

How might comparative studies between different species inform our understanding of RNF170 function?

Comparative studies across species can significantly enhance our understanding of RNF170 function in several ways:

  • Evolutionary conservation analysis:

    • Comparing RNF170 sequences and structures across species (from zebrafish to humans) reveals highly conserved domains that likely serve critical functions

    • The RING domain and transmembrane topology are particularly conserved, suggesting fundamental importance

  • Cross-species phenotypic comparisons:

    • Zebrafish knockdown models show developmental defects including microcephaly and motility issues

    • Canine models with RNF170 mutations display neuroaxonal dystrophy with pelvic limb weakness and ataxia

    • Human patients with RNF170 mutations develop hereditary spastic paraplegia (SPG85)

    • These phenotypic similarities across species highlight conserved neurological requirements for RNF170

  • Functional complementation experiments:

    • Testing whether human RNF170 can rescue phenotypes in Xenopus tropicalis or zebrafish models

    • Introducing specific mutations identified in human patients into different model organisms to compare functional consequences

The clinical similarities between human SPG85 patients and the canine model with RNF170 mutation suggest that fundamental pathological mechanisms are conserved across species , making comparative studies particularly valuable for translational research.

What are the optimal storage and handling conditions for recombinant Xenopus tropicalis RNF170?

Based on protocols for similar recombinant proteins, the recommended storage and handling conditions for recombinant Xenopus tropicalis RNF170 are:

ParameterRecommendationNotes
Storage temperature-20°C/-80°CAliquoting is necessary for multiple use
ReconstitutionDeionized sterile waterTo concentration of 0.1-1.0 mg/mL
Glycerol addition5-50% (final concentration)50% is recommended for long-term storage
Buffer compositionTris/PBS-based buffer with 6% Trehalose, pH 8.0Maintains protein stability
Freeze-thawAvoid repeated cyclesStore working aliquots at 4°C for up to one week
Pre-use preparationBrief centrifugationTo bring contents to bottom of vial

It's important to note that repeated freezing and thawing is not recommended, and working aliquots should be stored at 4°C for up to one week to maintain protein integrity .

What controls should be included when performing RNF170 knockdown or overexpression experiments?

When conducting RNF170 knockdown or overexpression experiments, the following controls should be included:

  • For knockdown experiments:

    • Scrambled/non-targeting morpholinos or siRNAs

    • Validation of knockdown efficiency by RT-PCR and/or Western blot

    • Rescue experiments with wildtype RNF170 to confirm specificity

    • Dose-response analysis to determine optimal concentration

  • For overexpression experiments:

    • Empty vector controls

    • Overexpression of catalytically inactive mutants (e.g., mutations in the RING domain)

    • Expression level verification by Western blot

    • GFP or other irrelevant protein expression as control

  • For both approaches:

    • Phenotypic assessment at multiple timepoints

    • Multiple readouts (e.g., IP3R levels, calcium imaging, developmental parameters)

    • Tissue-specific controls if using targeted expression systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.