Recombinant Xenopus tropicalis S-adenosylmethionine mitochondrial carrier protein (slc25a26)

Shipped with Ice Packs
In Stock

Description

Conservation Across Species

The SLC25A26 gene is evolutionarily conserved, with homologs identified in humans, mice, fruit flies, yeast (Saccharomyces cerevisiae), and plants (Arabidopsis thaliana) . Key functional similarities include:

  • SAM/SAH Countertransport: Mediated by a multi-pass transmembrane structure .

  • Mitochondrial RNA Methylation: Critical for ribosomal assembly and translation .

  • Impact on CoQ10 and Lipoic Acid Synthesis: Defects in SLC25A26 disrupt these pathways, impairing electron transport chain (ETC) activity .

Disease Mechanisms in Humans vs. Model Organisms

AspectHuman StudiesModel Organisms
PhenotypeNeonatal lactic acidosis, mitochondrial myopathyDevelopmental lethality in Drosophila
Transport DefectImpaired SAH efflux → SAH accumulation SAMC knockout → mitochondrial dysfunction
Therapeutic TargetsEnhancing SAH transport, CoQ10 supplementationGenetic rescue studies in mice/flies

Applications and Research Gaps

Potential Applications:

  • Cancer Research: SLC25A26 dysregulation impacts mitochondrial DNA methylation and chemosensitivity . Overexpression may enhance cisplatin efficacy by increasing oxidative stress .

  • Cardiac Hypertrophy: SLC25A26 modulates mitochondrial SAM/SAH balance, influencing mitophagy and mitochondrial dynamics .

Research Gaps:

  • Xenopus-Specific Data: No direct studies on recombinant X. tropicalis SLC25A26. Functional validation via heterologous expression (e.g., in E. coli or insect cells) is needed.

  • Kinetics and Regulation: Limited data on substrate affinity, pH dependence, or post-translational modifications in Xenopus.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
slc25a26; samc; S-adenosylmethionine mitochondrial carrier protein; Mitochondrial S-adenosylmethionine transporter; Solute carrier family 25 member 26
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-269
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
slc25a26
Target Protein Sequence
MERREFCASLLAGGTAGMCVDLILFPLDTIKTRLQSPLGFSKSGGFRGIYAGVPSTAVGS FPNAAAFFVTYESAKQLLRSDSSYLSPIIHMAAASLGEVVACLIRVPSEVIKQRAQVSPS STTYQMLSATLRQEGIKGLYRGYKSTVLREIPFSLVQFPLWESLKDLWSWKQGRAVDSWQ SAVCGAFAGGFAAALTTPLDVAKTRIMLAKAGSGVASGNVLFALHEIWRTQGIMGLFAGV IPRMTAISLGGFIFLGAYDKVRTLMLREQ
Uniprot No.

Target Background

Function
Mitochondrial solute carriers facilitate the transport of metabolites, nucleotides, and cofactors across the mitochondrial inner membrane. This protein specifically mediates the mitochondrial import of S-adenosylmethionine (SAM).
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does Xenopus tropicalis SLC25A26 compare structurally to human SLC25A26?

Xenopus tropicalis SLC25A26 and human SLC25A26 share significant structural similarities due to evolutionary conservation of the mitochondrial carrier family proteins. The Xenopus tropicalis protein consists of 269 amino acids , while maintaining the characteristic features of the mitochondrial carrier family. Both proteins contain transmembrane domains that anchor them to the mitochondrial inner membrane, with a structure optimized for substrate recognition and transport .

The amino acid sequence of Xenopus tropicalis SLC25A26 (UniProt ID: Q6GLA2) includes conserved regions typical of mitochondrial carriers . When comparing the sequences, both proteins maintain the functional domains necessary for SAM/SAH transport. This high degree of conservation suggests that the mechanism of transport is similar across species, making Xenopus tropicalis a valuable model organism for studying SLC25A26 function in a developmental context.

What role does SLC25A26 play in Xenopus embryonic development?

SLC25A26 plays a critical role in Xenopus embryonic development through its impact on SAM availability in mitochondria. Studies in Xenopus have shown that proper regulation of SAM levels is essential for normal embryonic development, particularly during the transition from blastula to gastrula stages .

Research has demonstrated that when S-adenosylmethionine decarboxylase (SAMDC), an enzyme that affects SAM metabolism, is overexpressed in Xenopus embryos, it causes a SAM-deficient state that leads to cell dissociation and inhibition of the blastula-gastrula transition . While this study doesn't directly manipulate SLC25A26, it highlights the importance of SAM metabolism in Xenopus development. Since SLC25A26 is the primary transporter of SAM into mitochondria, it likely plays a crucial role in maintaining the appropriate levels of SAM required for normal embryonic development, particularly for the methylation of mitochondrial components necessary for proper cellular differentiation and morphogenesis.

How can recombinant Xenopus tropicalis SLC25A26 be optimized for functional studies?

Optimizing recombinant Xenopus tropicalis SLC25A26 for functional studies requires attention to several critical parameters:

Expression System Selection: Mammalian cell expression systems have proven effective for producing functional recombinant SLC25A26, as evidenced by commercially available preparations . For functional studies, mammalian cells provide the appropriate cellular machinery for proper folding and post-translational modifications of membrane proteins like SLC25A26.

Protein Purification Strategy: For mitochondrial membrane proteins like SLC25A26, a staged purification approach is recommended:

  • Initial isolation of mitochondrial fractions

  • Solubilization using mild detergents (e.g., digitonin or n-dodecyl-β-D-maltoside)

  • Affinity chromatography using the His-tag present in recombinant versions

  • Size exclusion chromatography for final purification

Functional Reconstitution: To assess transport activity, reconstitution into liposomes containing appropriate phospholipid compositions that mimic the mitochondrial inner membrane is essential. This can be followed by transport assays using radiolabeled SAM to measure uptake rates and kinetics.

Storage Optimization: Research-grade SLC25A26 should be stored in a Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for long-term preservation . Avoiding repeated freeze-thaw cycles is critical for maintaining functional integrity.

How does SLC25A26 function differ between developmental stages in Xenopus tropicalis?

The function of SLC25A26 likely varies across Xenopus tropicalis developmental stages, though direct evidence is limited in the provided sources. Based on related research, we can infer several key aspects:

Early Embryonic Stages (Blastula to Gastrula): During these critical transitions, SAM metabolism plays a vital role. Studies with SAMDC overexpression demonstrate that SAM deficiency during this period leads to cell dissociation and developmental arrest . This suggests that SLC25A26-mediated SAM transport is likely tightly regulated during these stages to ensure appropriate methylation of mitochondrial components.

Tissue Differentiation Stages: As various tissues differentiate, their mitochondrial methylation requirements likely change. SLC25A26 expression and activity may be upregulated in tissues with high energy demands or extensive mitochondrial biogenesis.

Metamorphosis: This unique amphibian developmental process involves substantial tissue remodeling and mitochondrial reorganization, potentially requiring adjusted SLC25A26 activity to support changing methylation patterns.

To investigate these stage-specific differences, researchers should consider:

  • Quantifying SLC25A26 expression levels across developmental timepoints using qPCR and Western blotting

  • Performing immunohistochemistry to determine tissue-specific localization patterns

  • Conducting functional transport assays using mitochondria isolated from different developmental stages

  • Employing targeted knockdown approaches at specific developmental timepoints to assess stage-specific requirements

What are the optimal conditions for expressing and purifying recombinant Xenopus tropicalis SLC25A26?

Optimal expression and purification of recombinant Xenopus tropicalis SLC25A26 requires careful consideration of several technical parameters:

Expression System:

  • Mammalian cell expression systems (particularly HEK293 or CHO cells) provide the most appropriate cellular environment for proper folding and post-translational modifications

  • Expression constructs should include a His-tag or other affinity tag for purification purposes

  • Inducible expression systems may help mitigate potential toxicity from membrane protein overexpression

Culture Conditions:

  • For mammalian cells, culture at 37°C with 5% CO2 in appropriate growth medium

  • Consider temperature reduction to 30-32°C during protein expression phase to improve proper folding

  • Supplement with additional methionine to support SAM synthesis

Purification Protocol:

  • Cell lysis using gentle detergents or mechanical disruption

  • Mitochondrial isolation via differential centrifugation

  • Membrane solubilization using detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin

  • Metal affinity chromatography (e.g., Ni-NTA for His-tagged proteins)

  • Size exclusion chromatography for final purification

Quality Control:

  • Assess purity via SDS-PAGE (target >80% purity)

  • Verify identity via Western blot or mass spectrometry

  • Test endotoxin levels (should be <1.0 EU per μg)

  • Confirm protein folding via circular dichroism spectroscopy

Storage Recommendations:

  • Store in PBS buffer with 50% glycerol

  • Maintain at -20°C for short-term or -80°C for long-term storage

  • Avoid repeated freeze-thaw cycles by preparing single-use aliquots

What techniques are most effective for studying SLC25A26 transport activity in Xenopus tropicalis mitochondria?

Several complementary techniques can be employed to effectively study SLC25A26 transport activity in Xenopus tropicalis mitochondria:

Isolated Mitochondria Transport Assays:

  • Isolate intact mitochondria from Xenopus tissues or embryos using differential centrifugation

  • Measure SAM uptake using radiolabeled substrates (e.g., [³H]-SAM)

  • Quantify transport kinetics by varying substrate concentrations and determining Km and Vmax values

  • Assess counter-exchange by pre-loading mitochondria with potential exchange substrates (SAH, SAC)

Liposome Reconstitution Systems:

  • Purify recombinant SLC25A26 as described in 3.1

  • Reconstitute protein into liposomes with defined phospholipid composition

  • Assess transport activity using fluorescent SAM analogs or radiolabeled substrates

  • This approach allows precise control of lipid environment and substrate concentrations

Electrophysiological Approaches:

  • Incorporate purified SLC25A26 into planar lipid bilayers

  • Measure ion currents associated with transport activity

  • This approach provides insights into the electrogenicity of the transport process

In vivo Mitochondrial SAM Quantification:

  • Utilize CRISPR/Cas9 to modulate SLC25A26 expression levels

  • Isolate mitochondria from modified cells/embryos

  • Quantify mitochondrial SAM levels using HPLC-MS/MS

  • Correlate SAM levels with SLC25A26 expression/activity

When executing these methods, researchers should be mindful of:

  • The temperature-sensitivity of transport activity in poikilothermic species like Xenopus

  • The potential impact of developmental stage on transport kinetics

  • The possible regulatory effects of other mitochondrial metabolites

How can CRISPR/Cas9 gene editing be optimized for studying SLC25A26 function in Xenopus tropicalis?

Optimizing CRISPR/Cas9 gene editing for studying SLC25A26 function in Xenopus tropicalis requires careful consideration of several technical aspects:

Guide RNA Design:

  • Target conserved functional domains of SLC25A26 for knockout studies

  • For knock-in studies (e.g., fluorescent tags), target regions that won't disrupt transport activity

  • Use Xenopus-specific genome databases to identify optimal target sites with minimal off-target effects

  • Design multiple guide RNAs to increase editing efficiency

Delivery Methods:

  • Microinjection into fertilized eggs at the one-cell stage is most effective

  • Optimize Cas9 mRNA or protein concentration (typically 250-500 pg/embryo)

  • Guide RNA concentration should be approximately 200-300 pg/embryo

  • Include repair template DNA for knock-in experiments (typically 10-20 pg/embryo)

Validation Strategies:

  • T7 endonuclease assay or direct sequencing to confirm editing

  • qPCR and Western blotting to verify expression changes

  • Mitochondrial isolation followed by transport assays to confirm functional effects

  • Developmental phenotyping to assess biological consequences

Experimental Controls:

  • Include Cas9-only and guide RNA-only controls

  • Perform rescue experiments with wild-type SLC25A26 mRNA to confirm specificity

  • Generate heterozygous mutants to assess gene dosage effects

Phenotypic Analysis:

  • Monitor developmental progression, particularly during blastula-gastrula transition

  • Assess mitochondrial function using respirometry

  • Evaluate mitochondrial methylation patterns using methylation-specific sequencing

  • Analyze embryonic cell behavior, particularly looking for dissociation phenotypes reminiscent of SAM deficiency

This approach can reveal the developmental and metabolic consequences of SLC25A26 dysfunction in a vertebrate model system, potentially providing insights relevant to human mitochondrial diseases associated with methylation defects.

How does Xenopus tropicalis SLC25A26 compare functionally to other model organisms?

Xenopus tropicalis SLC25A26 shares functional similarities with its counterparts in other model organisms, though with species-specific adaptations:

Comparison with Yeast (Sam5p/Pet8p):

  • Both catalyze SAM/SAH exchange across mitochondrial membranes

  • Yeast Sam5p (now called Pet8p) is encoded by the PET8 gene

  • Yeast carrier has broader substrate specificity, also transporting S-adenosylcysteine (SAC) and adenosylornithine

  • The yeast system provides a simpler genetic background for functional studies

Comparison with Arabidopsis (SAMC1/SAMC2):

  • Arabidopsis has two isoforms (SAMC1, SAMC2) compared to the single isoform in Xenopus

  • SAMC1 has dual localization in mitochondria and chloroplasts, while Xenopus SLC25A26 is strictly mitochondrial

  • Both organisms' carriers transport SAM and SAH, with Arabidopsis carriers also handling SAC

  • Plant-specific adaptations reflect the additional need for methylation in chloroplasts

Comparison with Human SLC25A26:

  • Both function primarily as SAM/SAH exchangers

  • Human SLC25A26 has been implicated in cancer biology, with studies suggesting it may serve as a therapeutic target

  • Human SLC25A26 mutations cause a specific mitochondrial disease phenotype

  • The high conservation suggests Xenopus can serve as a valuable model for human mitochondrial methylation disorders

This comparative perspective highlights the evolutionary conservation of this transport system while revealing adaptations to species-specific metabolic requirements. Researchers investigating Xenopus SLC25A26 should consider these comparative aspects when designing experiments and interpreting results.

What insights can Xenopus tropicalis SLC25A26 studies provide for understanding human mitochondrial diseases?

Studying SLC25A26 in Xenopus tropicalis offers valuable insights for understanding human mitochondrial diseases through several important connections:

Developmental Disease Modeling:
Xenopus embryos provide an excellent system for studying developmental consequences of mitochondrial dysfunction. The observation that SAM deficiency in Xenopus embryos leads to cell dissociation and developmental arrest at the blastula-gastrula transition suggests that SLC25A26 dysfunction could contribute to developmental disorders. This model allows researchers to investigate how disruptions in mitochondrial methylation affect embryonic development, potentially explaining certain congenital mitochondrial diseases.

Mitochondrial Methylation Disorders:
Human mutations in SLC25A26 have been associated with mitochondrial disease . Xenopus studies can help elucidate the mechanistic links between impaired SAM transport and specific disease phenotypes. By manipulating SLC25A26 function in different tissues and developmental stages, researchers can map the consequences of methylation deficiencies on mitochondrial function, potentially revealing tissue-specific vulnerabilities relevant to human patients.

Cancer Biology Connections:
Recent research suggests SLC25A26 may be a potential therapeutic target in cancer treatment . The methionine cycle and SAM metabolism have been implicated in cancer cell proliferation, with tumor cells often showing high activity in these pathways . Xenopus models allow for detailed investigation of how alterations in SLC25A26 expression affect cellular metabolism and proliferation in a developmental context, potentially revealing new therapeutic strategies.

Comparative Pathway Analysis:
By comparing the methylation-dependent processes in Xenopus and human mitochondria, researchers can identify conserved pathways critical for mitochondrial function. This comparative approach may reveal previously unrecognized methylation targets or regulatory mechanisms relevant to human disease.

To maximize the translational value of Xenopus SLC25A26 research, investigators should:

  • Generate models with mutations corresponding to known human pathogenic variants

  • Perform detailed phenotypic analyses across multiple organ systems

  • Conduct cross-species rescue experiments to test functional conservation

  • Integrate findings with human patient data to validate disease mechanisms

How do the experimental properties of recombinant Xenopus tropicalis SLC25A26 differ from those of zebrafish and human variants?

The experimental properties of recombinant SLC25A26 from different species show important differences that researchers should consider when designing comparative studies:

Protein Preparation Characteristics:

PropertyXenopus tropicalisZebrafishHuman
Expression SystemMammalian cells Mammalian cells Mammalian cells
Molecular Weight~33 kDaNot specified~33-35 kDa
Purification TagsHis-tag His-tag Various available
Storage BufferTris-based with 50% glycerol PBS buffer Species-dependent
StabilityStore at -20°C to -80°C Store at -20°C to -80°C Similar storage conditions

Functional Characteristics:

Xenopus tropicalis SLC25A26 likely functions optimally at lower temperatures (20-25°C) consistent with the organism's biology, while human SLC25A26 operates best at 37°C. Zebrafish SLC25A26 would have intermediate temperature preferences (around 28°C). These temperature optima affect experimental design when comparing transport activities.

Antibody Cross-Reactivity:

Commercial antibodies developed against human SLC25A26 (like ab175209 ) may have variable cross-reactivity with the Xenopus and zebrafish homologs due to sequence differences. Researchers should validate antibody specificity when working across species.

Substrate Specificity:

While all three species' transporters primarily mediate SAM/SAH exchange, subtle differences in substrate specificity or transport kinetics may exist. These differences could be particularly important when using the proteins for in vitro transport assays or when developing species-specific inhibitors.

Experimental Applications:

Xenopus tropicalis SLC25A26 is particularly valuable for developmental studies due to the experimental accessibility of Xenopus embryos and the established role of SAM metabolism in early development . Zebrafish SLC25A26 offers advantages for high-throughput screening and in vivo imaging studies. Human SLC25A26 remains the gold standard for direct biomedical applications.

Researchers should carefully consider these species-specific properties when designing comparative studies or selecting the optimal model system for their specific research questions.

What are the most promising approaches for studying the role of SLC25A26 in embryonic development using Xenopus tropicalis?

Several innovative approaches show particular promise for elucidating SLC25A26's role in Xenopus tropicalis embryonic development:

Tissue-Specific and Inducible Knockdown/Knockout:

  • Develop tissue-specific CRISPR/Cas9 systems to target SLC25A26 in specific embryonic tissues

  • Employ photo-activatable morpholinos for temporal control of SLC25A26 knockdown

  • Design hormone-inducible Cre-lox systems for conditional gene inactivation

  • These approaches would help determine tissue-specific requirements for mitochondrial SAM transport during development

Mitochondrial Methylome Analysis:

  • Implement mitochondrial DNA/RNA methylation profiling using bisulfite sequencing and methylated RNA immunoprecipitation

  • Compare methylation patterns between wild-type and SLC25A26-deficient embryos

  • Correlate methylation changes with developmental phenotypes

  • This would establish direct links between SLC25A26 function and specific methylation events

Live Imaging of Mitochondrial Dynamics:

  • Generate fluorescently tagged SLC25A26 knock-in lines

  • Combine with mitochondrial markers to track changes in mitochondrial morphology and distribution

  • Perform time-lapse imaging during critical developmental transitions, particularly blastula-gastrula

  • This approach would reveal spatial-temporal dynamics of SLC25A26 during development

Metabolomic Profiling:

  • Conduct targeted metabolomics focusing on SAM, SAH, methionine cycle intermediates, and polyamines

  • Sample at multiple developmental timepoints and in different tissues

  • Correlate metabolite fluctuations with SLC25A26 expression patterns

  • This would establish the metabolic consequences of altered SLC25A26 function

Rescue Experiments:

  • In SLC25A26-deficient embryos, attempt rescue with microinjection of:

    • Wild-type SLC25A26 mRNA

    • SAM directly into mitochondria

    • Products of mitochondrial methylation reactions

  • These experiments would help distinguish primary from secondary effects of SLC25A26 dysfunction

These approaches, particularly when used in combination, would provide unprecedented insights into how mitochondrial methylation contributes to embryonic development and potentially reveal new principles of developmental regulation.

How can recombinant Xenopus tropicalis SLC25A26 be used to screen for potential therapeutic compounds?

Recombinant Xenopus tropicalis SLC25A26 offers several advantages as a platform for therapeutic compound screening, particularly for identifying modulators of mitochondrial methylation:

Liposome-Based Transport Assays:

  • Reconstitute purified recombinant SLC25A26 into liposomes

  • Develop fluorescence-based assays using SAM analogs with fluorescent tags

  • Conduct high-throughput screening of compound libraries to identify:

    • Inhibitors (potentially useful for cancer therapy )

    • Activators (potentially beneficial for mitochondrial disease treatment)

  • Validate hits using radiolabeled substrate transport assays

Cell-Based Screening Systems:

  • Generate cell lines stably expressing Xenopus tropicalis SLC25A26

  • Develop reporter systems linked to mitochondrial methylation events

  • Screen for compounds that modulate SLC25A26 function in a cellular context

  • This approach incorporates cellular permeability and toxicity filters

Structural Biology Approaches:

  • Use purified recombinant protein for structural determination via:

    • X-ray crystallography

    • Cryo-electron microscopy

    • NMR studies of specific domains

  • Implement virtual screening against the structural model

  • Validate in silico hits using functional assays

  • This structure-based approach would enable rational drug design

Comparative Screening Strategy:

  • Conduct parallel screens using SLC25A26 from Xenopus, zebrafish, and human

  • Identify compounds with species-specific or conserved effects

  • Use evolutionary conservation as a filter for identifying compounds targeting functional hotspots

  • This comparative approach increases the translational potential of discoveries

Validation Pipeline:

  • Test top compounds in Xenopus embryos for:

    • Effects on development

    • Mitochondrial function

    • Methylation patterns

  • Assess specificity by comparing effects in wild-type versus SLC25A26-deficient embryos

  • Evaluate safety profiles using developmental toxicity assays

  • This in vivo validation provides early insights into compound efficacy and safety

This systematic approach leverages the advantages of the Xenopus system while maintaining focus on therapeutic potential, particularly for conditions involving mitochondrial methylation defects or cancer-related alterations in SAM metabolism.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.