Recombinant Xenopus tropicalis Selenoprotein S (sels)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
vimp; sels; TNeu072i15.1; Selenoprotein S; SelS; VCP-interacting membrane protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
vimp
Target Protein Sequence
MELGNQPGPGNRPEIELEWYQYLQNTVGVVLSSYGWYILLGCILIYLLIQKLPQNFTRAG TSNHSTVTDPDEIVRRQEAVTAARLRMQEELNAQAELYKQKQVQLQEEKRQRNIETWDRM KEGKSSKVACRLGQEPSPSTSTSAATKPKQEKQERKTLRGSGYNPLTGDGGGTCAWRPGR RGPSSGGUG
Uniprot No.

Target Background

Function

Selenoprotein S (SelS) is involved in the degradation pathway of misfolded endoplasmic reticulum (ER) luminal proteins. It facilitates the transfer of these misfolded proteins from the ER to the cytosol, where they are subsequently degraded by the ubiquitin-proteasome system.

Database Links

KEGG: xtr:496967

UniGene: Str.11154

Protein Families
Selenoprotein S family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein. Cytoplasm.

Q&A

What is Selenoprotein S and why is it studied in Xenopus tropicalis?

Selenoprotein S (SELS) is a selenocysteine-containing protein that belongs to the selenoprotein family. It contains at least one selenocysteine (Sec) residue at its active site, which is encoded by the UGA codon that normally signals translation termination. SELS serves oxidoreductase functions and is primarily localized in the endoplasmic reticulum. Xenopus tropicalis represents an excellent model organism for studying selenoproteins due to its relatively fast development, diploid genome, and conservation of selenoprotein functions across vertebrates. The study of SELS in Xenopus tropicalis provides valuable insights into the evolutionary conservation of selenoprotein function and its role in vertebrate development and physiology .

What are the known gene names and synonyms for Xenopus tropicalis Selenoprotein S?

The Xenopus tropicalis Selenoprotein S is known by several gene names and synonyms which are important to recognize when conducting literature searches and database queries:

Primary DesignationAlternative Gene NamesOther Names
selsvimp, ADO15, SBBI8, seps1, AD-015Selenoprotein S, VCP-interacting membrane selenoprotein

These various naming conventions reflect both the function and historical characterization of this protein in different research contexts .

How is selenocysteine incorporated into Xenopus tropicalis SELS?

Selenocysteine (Sec) incorporation in Xenopus tropicalis SELS occurs through a specialized translation mechanism. The UGA codon, which typically functions as a stop codon, is recoded to specify selenocysteine insertion. This process requires the presence of a conserved stem-loop structure in the 3' UTR of the mRNA called the Sec insertion sequence (SECIS) element. The insertion mechanism involves multiple components including a specialized tRNA[Ser]Sec, phosphoseryl-tRNA kinase (PSTK), and selenocysteine synthase (SecS). The selenium donor for this process is selenophosphate, which is generated by selenophosphate synthetase 2 (SPS2). This complex machinery ensures the proper incorporation of selenocysteine at specific UGA codons within the SELS protein sequence, which is essential for its catalytic function .

What expression systems are optimal for producing recombinant Xenopus tropicalis SELS?

Several expression systems can be used to produce recombinant Xenopus tropicalis SELS, each with distinct advantages depending on research requirements:

Expression SystemAdvantagesConsiderations
Cell-Free ExpressionRapid production, avoids cellular toxicity, suitable for proteins that may affect cell viabilityMay have lower yields, higher cost
E. coliHigh yield, cost-effective, well-established protocolsMay lack post-translational modifications, potential folding issues
YeastEukaryotic post-translational modifications, secretion possibleLonger production time than E. coli
Baculovirus/InsectComplex eukaryotic modifications, high expression levelsMore complex system to establish
Mammalian CellMost authentic post-translational modificationsHighest cost, lower yields, longer production times

The choice depends on the specific research requirements, particularly whether post-translational modifications are critical for the study. For basic structural studies, cell-free expression or E. coli systems may be sufficient, while functional studies might require eukaryotic expression systems to ensure proper folding and modification .

What purification challenges are specific to Xenopus tropicalis SELS?

Purifying Xenopus tropicalis SELS presents several unique challenges related to its selenocysteine content and membrane association. The presence of highly reactive selenocysteine residues makes the protein susceptible to oxidation during purification, potentially affecting its structure and function. Additionally, as SELS is a membrane-associated protein (being described as a VCP-interacting membrane selenoprotein), solubilization requires careful selection of detergents or other solubilizing agents.

Standard purification protocols should be modified to include:

  • Reducing agents throughout purification (such as DTT or β-mercaptoethanol)

  • Oxygen-free environments when possible

  • Appropriate detergents for membrane protein solubilization

  • Quick processing times to minimize oxidation exposure

Most commercial preparations achieve ≥85% purity as determined by SDS-PAGE, which represents a balance between yield and purity suitable for most research applications .

How can RNA-seq data inform studies of SELS expression in Xenopus tropicalis development?

RNA-seq databases provide valuable insights into the temporal expression patterns of sels during Xenopus tropicalis development. By analyzing comprehensive RNA-seq datasets spanning multiple developmental stages (from 2-cell embryos through tadpole stages), researchers can determine precisely when sels is expressed during development. This temporal expression profiling helps identify developmental windows when SELS likely plays critical functional roles.

Several searchable databases of Xenopus RNA-seq expression profiles are available to researchers:

  • The Gilchrist/Cho/Khokha database covering 0 to 66 hours post-fertilization

  • Databases covering early embryogenesis (0 to 10 hours post-fertilization)

  • Comprehensive transcriptome datasets spanning from 2-cell embryos through tadpole stages

These resources allow researchers to:

  • Compare sels expression with that of other selenoproteins

  • Identify co-expressed genes that may functionally interact with sels

  • Determine whether sels is maternally expressed or activated after the mid-blastula transition

  • Correlate expression patterns with developmental events to inform hypothesis development

This expression data is essential for designing stage-specific experiments and understanding the developmental context of SELS function .

What experimental approaches can determine SELS function in Xenopus tropicalis?

Multiple complementary experimental approaches can elucidate SELS function in Xenopus tropicalis:

ApproachMethodologyInformation Gained
Morpholino knockdownMicroinjection of antisense morpholinos targeting sels mRNALoss-of-function effects during early development
CRISPR/Cas9 genome editingGeneration of sels mutant linesComplete loss-of-function phenotypes throughout development
Transgenic overexpressionCreation of transgenic lines with fluorescent-tagged SELSProtein localization, temporal/spatial expression
Explant culturesIsolation of tissues expressing SELS for in vitro manipulationTissue-specific functions and responses
Selenium depletion/supplementationManipulation of selenium levels in culture mediaImpact on SELS activity and isoform distribution

The transgenic approach is particularly powerful, as demonstrated by existing Xenopus tropicalis transgenic lines. These methodologies allow visualization of gene expression patterns and responses to experimental manipulations, such as those used in studies of induction in embryonic tissue recombinants and explants .

How does SELS function differ between mcm5U and mcm5Um tRNA isoforms in Xenopus?

Selenoprotein synthesis in vertebrates, including Xenopus, is regulated by two distinct tRNA[Ser]Sec isoforms containing either mcm5U or mcm5Um at position 34. These isoforms exhibit different functional properties and respond differently to selenium status:

tRNA IsoformSelenium Status EffectAssociated SelenoproteinsFunctional Implications
mcm5UPredominant during Se deficiencyHousekeeping selenoproteins (e.g., thioredoxin reductases)Maintains essential selenoprotein synthesis during limited selenium availability
mcm5UmPredominant during Se supplementationStress-related selenoproteins (including SELS)Enhances expression of stress-response selenoproteins when selenium is abundant

This differential regulation suggests that SELS in Xenopus tropicalis likely responds to selenium status and is preferentially synthesized under conditions of selenium supplementation via the mcm5Um isoform. This has important implications for experimental design, as selenium availability in culture conditions or animal diets may significantly impact SELS expression levels and function. Understanding this regulatory mechanism is crucial for interpreting experimental results and designing interventions to modulate SELS activity .

What are the critical factors for designing antibodies against Xenopus tropicalis SELS?

Designing effective antibodies against Xenopus tropicalis SELS presents several challenges that must be addressed:

  • Epitope selection: Choose regions that:

    • Avoid the selenocysteine residue (which can be chemically reactive)

    • Target unique sequences not conserved in other selenoproteins

    • Are predicted to be accessible (not buried in membrane regions)

  • Cross-reactivity considerations: Due to high conservation of selenoproteins across species, ensure specificity by:

    • Comparing sequences between Xenopus tropicalis, Xenopus laevis, and other model organisms

    • Testing for cross-reactivity with other selenoprotein family members

  • Validation methods: Confirm antibody specificity through:

    • Western blot analysis comparing wild-type and SELS-depleted samples

    • Immunoprecipitation followed by mass spectrometry

    • Immunohistochemistry with appropriate controls

Based on available information, rabbit polyclonal antibodies have been successfully used for applications including ELISA and Western blot analysis of selenoproteins in zebrafish, suggesting similar approaches would be effective for Xenopus tropicalis SELS .

How can selenium supplementation be optimized in Xenopus tropicalis studies involving SELS?

Optimizing selenium supplementation is crucial for studies of selenoproteins, including SELS, in Xenopus tropicalis:

Selenium SourceConcentration RangeAdvantagesLimitations
Sodium selenite5-100 nMWell-characterized, readily availableCan be toxic at higher concentrations
Selenomethionine0.1-1 μMLess toxic, more physiologicalVariable incorporation into proteins
Methylseleninic acid0.5-5 μMRapid cellular uptakeMay have non-specific effects

When conducting selenium supplementation experiments:

  • Include multiple selenium concentrations to establish dose-response relationships

  • Monitor both selenoprotein expression and potential toxicity markers

  • Consider the differential effects on mcm5U and mcm5Um tRNA isoforms

  • Account for background selenium levels in culture media or animal diets

  • Allow sufficient time (12-48 hours) for selenoprotein synthesis to respond to supplementation

Selenium status directly influences the distribution of tRNA[Ser]Sec isoforms, with the mcm5Um isoform (which preferentially synthesizes stress-related selenoproteins like SELS) becoming more abundant under selenium supplementation. This makes careful selenium calibration essential for accurate interpretation of SELS functional studies .

How conserved is SELS structure and function across Xenopus species and other vertebrates?

Selenoprotein S demonstrates significant evolutionary conservation across vertebrate species, including between Xenopus tropicalis and other model organisms:

SpeciesGene Name(s)Notable Structural FeaturesFunctional Conservation
Xenopus tropicalissels, vimp, ADO15, SBBI8, seps1, AD-015Contains selenocysteine in active siteVCP-interacting membrane selenoprotein
Xenopus laevissels-a (L homeolog), sels-b (S homeolog)Two homeologs due to tetraploidySimilar function to X. tropicalis ortholog
Danio rerio (zebrafish)sels, vimp, wu:fc16a03, zgc:136970Conserved selenocysteineMembrane-associated selenoprotein
MouseSels, Vimp, H47, H4, H-4, H-47, C78786, 1500011E07RikConserved selenocysteineVCP-interacting membrane protein
HumanSELS, SELENOS, VIMPThioredoxin-like fold, CxxU motifER-stress response, redox function

The conservation of structural features, particularly the selenocysteine residue and thioredoxin-like fold with a conserved CxxU motif, strongly suggests functional conservation in redox pathways across vertebrate evolution. The availability of both X. tropicalis and X. laevis models provides unique opportunities to study SELS function in closely related species with different ploidy levels .

What transgenic approaches could advance understanding of SELS function in Xenopus tropicalis?

Transgenic approaches offer powerful tools for investigating SELS function in Xenopus tropicalis. Based on successful transgenic strategies with other genes, several approaches could be particularly valuable:

  • Fluorescent reporter transgenic lines:

    • Creating SELS promoter-driven fluorescent reporters (similar to established Pax-6, Otx-2, Rx, and EF1alpha lines)

    • Developing fusion proteins with SELS tagged with fluorescent proteins to track subcellular localization

  • Inducible expression/knockdown systems:

    • Tetracycline-inducible SELS expression for temporal control

    • Conditional CRISPR systems for stage-specific gene disruption

  • Multi-reporter strategies:

    • Combining SELS reporters with markers for ER stress or UPR activation

    • Creating lines with multiple selenoprotein reporters to study coordinated regulation

A revised protocol for transgenesis in X. tropicalis has significantly increased the percentage of transgenic animals reaching adulthood, making these approaches increasingly feasible. These transgenic approaches would allow real-time visualization of SELS expression and function during development and in response to various stressors, substantially advancing our understanding of selenoprotein biology in vertebrate development .

How might high-resolution techniques reveal SELS function at the cellular level?

Advanced high-resolution techniques can provide unprecedented insights into SELS function at the cellular and subcellular levels:

TechniqueApplication to SELS ResearchPotential Discoveries
Super-resolution microscopyVisualizing SELS distribution in ER membranesPrecise subcellular localization and potential microdomains
Proximity labeling (BioID, APEX)Identifying SELS interaction partnersNovel protein associations beyond known VCP interaction
CRISPR-based screeningSystematic identification of genetic interactorsPathways functionally connected to SELS activity
Single-cell RNA-seqCell-type specific expression patternsDifferential expression across tissues during development
Cryo-electron microscopyStructural analysis of SELS complexesMolecular mechanism of selenocysteine-dependent catalysis

Combined with the extensive RNA-seq datasets available for Xenopus tropicalis, these approaches could integrate temporal expression data with spatial, structural, and functional information to construct comprehensive models of SELS activity throughout development and in response to various cellular stresses .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.