Recombinant Xenopus tropicalis Serine palmitoyltransferase small subunit B (sptssb)

Shipped with Ice Packs
In Stock

Description

Protein Structure and Function

sptssb is a small subunit of the SPT holoenzyme, which typically comprises two large subunits (SPTLC1/2) and a small subunit (sptssa or sptssb). In Xenopus tropicalis, the recombinant sptssb protein has the following characteristics:

PropertyDetailSource
Uniprot IDB0S4Q1
LengthFull-length protein (1–80 amino acids) ,
SequenceMDVKHIKDYLSWLYYQYLLITCSYVLEPWEQSIFNTLLLTIIAMVIYSSYIFIPIHVRLAVEFFSGIFGGQHESTVALMS ,
Expression SystemE. coli (with N-terminal 10xHis-tag) ,
Purity≥85% (confirmed via SDS-PAGE) ,

The protein stimulates SPT activity by altering substrate affinity and specificity, influencing the chain length of sphingolipid long-chain bases (LCBs) .

Biochemical Properties and Enzymatic Activity

sptssb modulates SPT activity by interacting with large subunits to regulate substrate binding. Key findings include:

Enzyme Kinetics

In Xenopus tropicalis and other models, sptssb mutations (e.g., Stellar in mice) increase SPT’s affinity for C18 fatty acyl-CoA substrates, elevating C20 LCB production . This gain-of-function effect is critical for studying sphingolipid homeostasis.

ParameterWild-Type SPTMutant SPT (Stellar)Source
Kₘ (C18 substrate)Higher50% lower (higher affinity)
VₘₐₓBasal activitySlightly increased

Research Applications

The recombinant sptssb is used in:

Sphingolipid Metabolism Studies

  • C20 LCB Production: Mutations in sptssb elevate C20 sphingosine and ceramides, linked to neurodegeneration and protein misfolding in mice .

  • Cancer Research: SPTSSB upregulation in prostate cancer (PCa) cells after anti-androgen therapy suggests its role in de novo sphingolipid synthesis and therapeutic resistance .

Cell Line Development

sptssb-expressing Xenopus cell lines (e.g., XTN-6, XTN-8) enable studies of sphingolipid pathways in developmental biology and disease modeling .

Neurodegeneration and Sphingolipid Imbalance

  • The Stellar mutation in mice increases C20 LCBs, causing axon degeneration and ubiquitinated protein accumulation .

  • Elevated C20 ceramides disrupt membrane integrity and protein homeostasis .

Cancer Metabolism

  • SPTSSB knockdown reduces de novo sphingolipid synthesis in AR-negative prostate cancer cells, enhancing therapeutic efficacy .

Developmental Biology

  • Xenopus cell lines (e.g., XTN-6) with sptssb expression are used to study immortalization and sphingolipid-dependent signaling .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
sptssb; admp; sssptb; Serine palmitoyltransferase small subunit B; Protein ADMP; Small subunit of serine palmitoyltransferase B; ssSPTb
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-80
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
sptssb
Target Protein Sequence
MDVKHIKDYLSWLYYQYLLITCSYVLEPWEQSIFNTLLLTIIAMVIYSSYIFIPIHVRLA VEFFSGIFGGQHESTVALMS
Uniprot No.

Target Background

Function
Stimulates the activity of serine palmitoyltransferase (SPT). The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference.
Database Links
Protein Families
SPTSS family, SPTSSB subfamily
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.