Recombinant Xenopus tropicalis Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (sdhd)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us; we will prioritize its implementation.
Synonyms
sdhd; TNeu097k19.1; Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; CybS; Succinate dehydrogenase complex subunit D; Succinate-ubiquinone oxidoreductase cytochrome b small subunit; Succinate-ubiquinone reductase membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-152
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
Target Protein Sequence
LLIRPVPCLTQDHHMVQTSQIHTSPNHHAGSKAASMHWTSERALSVALLGLLPAAYLYPG AAMDYSLAAALTLHGHWGLGQVVTDYVHGDAKIKMANTSLFALSALTFAGLCYFNYHDVG ICKAVSMLWSL
Uniprot No.

Target Background

Function

This protein is the membrane-anchoring subunit of succinate dehydrogenase (SDH), a component of mitochondrial complex II in the electron transport chain. Its function is to transfer electrons from succinate to ubiquinone (coenzyme Q).

Database Links
Protein Families
CybS family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis sdhd and why is it significant as a research model?

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (sdhd) functions as a key component of mitochondrial Complex II (succinate dehydrogenase), participating in both the citric acid cycle and electron transport chain. This protein plays a critical role in cellular energy metabolism by catalyzing the oxidation of succinate to fumarate and transferring electrons to the ubiquinone pool. Xenopus tropicalis sdhd (specifically amino acids 22-152 of the mature protein) can be produced recombinantly with an N-terminal His tag in E. coli expression systems .

The significance of studying this protein in X. tropicalis stems from several factors. Unlike Xenopus laevis with its allotetraploid genome, X. tropicalis possesses a diploid genome that facilitates more straightforward genetic manipulation and analysis . Additionally, the high conservation between X. tropicalis and human genomes makes findings potentially translatable to human health contexts . The recombinant form enables biochemical and structural studies that illuminate energy metabolism mechanisms relevant to both developmental biology and mitochondrial disorders.

How does X. tropicalis compare to other model organisms for studying mitochondrial proteins?

Xenopus tropicalis offers several unique advantages for studying mitochondrial proteins like sdhd:

  • Genetic tractability: The diploid genome of X. tropicalis makes it significantly more amenable to genetic analysis than the allotetraploid X. laevis, allowing for more straightforward interpretation of genetic manipulations .

  • Experimental accessibility: A single pair of X. tropicalis can produce over 4,000 embryos in a day through natural mating or in vitro fertilization, providing abundant material for experimental replication .

  • External development: Embryos develop externally and transparently, allowing for direct visualization of developmental processes and easier access for experimental manipulations .

  • Temperature sensitivity: While X. tropicalis embryos develop at similar rates to X. laevis, they tolerate a narrower temperature range, which can be advantageous for temperature-controlled experiments examining mitochondrial function .

  • Unilateral mutation capability: CRISPR/Cas9 mutagenesis of one cell at the 2-cell stage creates embryos with one wild-type half and one mutant half, providing an internal control within the same organism – a feature unique to Xenopus that is particularly valuable for mitochondrial studies .

The combination of these features makes X. tropicalis particularly well-suited for studying proteins involved in energy metabolism and mitochondrial function in the context of development and disease.

What expression systems and purification methods are optimal for producing functional recombinant X. tropicalis sdhd protein?

  • Expression system selection:

    • E. coli: Suitable for basic biochemical studies, providing high yield but lacking post-translational modifications

    • Insect cells: Better for functional studies requiring proper membrane protein folding

    • Mammalian cells: Optimal for studies requiring mammalian-like post-translational modifications

  • Purification strategy:

    • Immobilized metal affinity chromatography (IMAC) using the His tag

    • Size exclusion chromatography for removing aggregates and obtaining homogeneous preparations

    • Consideration of detergents for membrane protein solubilization (critical for sdhd as a membrane-embedded protein)

  • Quality control assessments:

    • SDS-PAGE and Western blotting to confirm protein identity and purity

    • Mass spectrometry to verify the intact protein sequence

    • Activity assays to confirm functional integrity within the succinate dehydrogenase complex

When using the recombinant protein for functional studies, researchers should verify that it maintains properties consistent with native sdhd, particularly when studying its integration into Complex II.

How can CRISPR/Cas9 technology be optimized for studying sdhd function in X. tropicalis?

CRISPR/Cas9 mutagenesis has been well-established in X. tropicalis and offers powerful approaches for studying sdhd function . Optimization strategies include:

  • Guide RNA design considerations:

    • Target conserved functional domains within sdhd

    • Use algorithms to minimize off-target effects

    • Consider targeting different regions to generate allelic series (null versus hypomorphic mutations)

  • Delivery methods:

    • Microinjection of CRISPR components at the 1-cell stage for whole-embryo effects

    • Injection at the 2-cell stage (one cell only) for generating unilateral mutants with internal controls

    • Targeted injections based on the detailed fate map of early embryos for tissue-specific effects

  • Mutagenesis validation:

    • T7 endonuclease assays for initial screening

    • Sequencing to confirm exact mutations

    • Functional validation through activity assays or phenotypic analysis

  • Phenotypic analysis strategy:

    • Compare unilaterally injected embryos where half serves as an internal control

    • Use mitochondrial dyes to assess membrane potential changes

    • Measure metabolic parameters such as oxygen consumption and lactate production

The unilateral CRISPR approach is particularly valuable for studying essential genes like sdhd, as complete loss throughout the embryo might be lethal, whereas unilateral loss allows survival and phenotypic analysis .

What methodologies are most effective for analyzing the impact of sdhd mutations on mitochondrial function?

Several complementary methodologies can effectively analyze mitochondrial function following sdhd manipulation:

  • Membrane potential analysis:

    • Tetramethylrhodamine (TMRE) staining to measure mitochondrial membrane potential (Δψm)

    • Use of protonophores like CCCP as controls

    • Similar to approaches used in X. laevis neural stem progenitor cells studies

  • Metabolic profiling:

    • Respirometry to measure oxygen consumption rates in isolated mitochondria

    • Extracellular flux analysis to assess glycolytic rates

    • Metabolomics to measure TCA cycle intermediates, particularly succinate and fumarate

  • Imaging approaches:

    • Confocal microscopy of fluorescently labeled mitochondria to assess morphology

    • Electron microscopy to evaluate ultrastructural changes in cristae organization

    • Live imaging to track dynamic changes in mitochondrial networks

  • Biochemical assays:

    • Complex II-specific activity assays

    • Blue Native PAGE to analyze respiratory complex assembly

    • Western blotting to assess compensatory changes in other respiratory chain components

  • Transcriptomic analysis:

    • RNA-seq to identify gene expression changes in response to sdhd dysfunction

    • Pathway analysis to detect metabolic adaptations

A comprehensive experimental approach would integrate multiple methodologies to distinguish direct effects of sdhd manipulation from secondary adaptations, providing a more complete understanding of its role in mitochondrial function.

How can recombinant X. tropicalis sdhd be used to study metabolic shifts during development and regeneration?

Recombinant X. tropicalis sdhd provides a valuable tool for investigating metabolic transitions during development and regeneration:

  • Metabolic shift characterization:

    • Use as a standard in quantitative analyses of endogenous sdhd expression

    • Monitor changes in Complex II activity relative to glycolytic enzyme activities

    • Correlate with developmental stage-specific metabolic demands

  • Experimental approaches:

    • Activity assays with recombinant sdhd to establish baseline parameters

    • Metabolic flux analysis comparing oxidative phosphorylation versus glycolysis across developmental stages

    • Integration with data on mitochondrial membrane potential changes

Research in X. laevis has demonstrated that neural stem progenitor cells exhibit a transient metabolic shift toward glycolysis during spinal cord regeneration, with decreased mitochondrial membrane potential at 6 hours post-injury that returns to baseline by 24 hours . Similar metabolic flexibility might be present during normal development in X. tropicalis, and recombinant sdhd offers a tool to investigate the balance between oxidative phosphorylation and glycolysis.

The following data table represents hypothetical measurements during key developmental transitions:

Developmental StageComplex II ActivityGlycolytic RateMitochondrial Membrane PotentialKey Metabolic Characteristic
Early BlastulaLowHighModerateGlycolysis-dominant
NeurulationIncreasingHighIncreasingMetabolic transition
OrganogenesisHighModerateHighOXPHOS-dominant
MetamorphosisFluctuatingVariableDynamicTissue-specific regulation

What role does sdhd play in the metabolic switch between oxidative phosphorylation and glycolysis during regeneration?

Studies in X. laevis provide insights into how sdhd might function during metabolic switching in regenerative processes:

  • Temporal dynamics:

    • Neural stem progenitor cells (NSPCs) in X. laevis show decreased mitochondrial membrane potential at 6 hours post spinal cord injury, returning to baseline by 24 hours

    • This coincides with a shift toward glycolytic metabolism necessary for supporting cellular proliferation

  • Regulatory mechanisms:

    • mTORC1 signaling is rapidly and transiently activated following spinal cord injury, which is necessary for NSPC proliferation

    • The timing of mTORC1 activation aligns with glycolytic activation and precedes the peak of NSPC proliferation

  • Functional significance:

    • Highly proliferative cells characteristically shift toward aerobic glycolysis to support anabolic pathways for generating cellular building blocks

    • High lactate production can enhance proliferation by modifying cell cycle regulatory proteins

  • Research approaches:

    • TMRE staining to measure mitochondrial membrane potential changes

    • Assessment of lactate production as an indicator of glycolytic metabolism

    • Analysis of sdhd activity in relation to other metabolic enzymes during regeneration

Both regeneration in X. laevis and tail regeneration in X. tropicalis involve metabolic shifts toward aerobic glycolysis (Warburg effect), characterized by high glucose uptake, high lactate production, and functional mitochondria with oxidative phosphorylation . This metabolic flexibility appears to be a conserved feature across different regenerative processes and model organisms.

How can X. tropicalis sdhd research contribute to understanding human mitochondrial diseases?

Xenopus tropicalis offers several advantages for modeling human mitochondrial diseases involving sdhd dysfunction:

  • Genetic conservation and manipulation:

    • The diploid genome of X. tropicalis facilitates genetic analysis compared to the allotetraploid X. laevis

    • High conservation between X. tropicalis and human genomes makes findings potentially translatable

    • CRISPR/Cas9 technology allows introduction of specific disease-associated mutations

  • Experimental strengths:

    • The ability to generate thousands of genetically modified embryos allows high-throughput phenotypic analysis

    • Unilateral mutagenesis provides powerful internal controls for studying even severe phenotypes

    • Transparent embryos enable direct visualization of developmental defects

  • Translational applications:

    • Modeling rare mitochondrial disorders associated with Complex II dysfunction

    • Screening potential therapeutic compounds using large numbers of mutant embryos

    • Understanding developmental origins of mitochondrial disease manifestations

The cost-effective, rapid, and higher throughput nature of X. tropicalis makes it valuable for understanding gene function in relation to disease, particularly as patient-driven gene discovery expands significantly . This model complements mammalian systems by allowing initial characterization of disease mechanisms that can later be validated in more complex models.

What are the methodological considerations for studying the integration of sdhd into Complex II assembly?

Studying sdhd integration into Complex II requires specialized approaches:

  • Complex assembly analysis:

    • Blue Native PAGE to separate intact respiratory complexes

    • In-gel activity assays for Complex II function

    • Mass spectrometry to identify interacting partners

  • Structural considerations:

    • Membrane environment requirements for proper integration

    • Use of nanodiscs or liposomes to mimic native membrane conditions

    • Consideration of detergent selection for extraction and purification

  • Interaction studies:

    • Co-immunoprecipitation with antibodies against other Complex II subunits

    • Proximity labeling approaches to identify the interaction landscape

    • FRET-based assays to monitor protein-protein interactions in situ

  • Functional validation:

    • Succinate dehydrogenase activity assays to confirm proper assembly

    • Electron transfer measurements to validate catalytic function

    • Membrane potential assessments to confirm contribution to proton motive force

A comprehensive analysis would track both the incorporation of sdhd into Complex II and the functional consequences of proper versus improper assembly, providing insights into both normal mitochondrial function and disease mechanisms.

How should researchers interpret conflicting data regarding sdhd function across different developmental stages?

Interpreting variable or conflicting data on sdhd function requires careful consideration of several factors:

  • Developmental context specificity:

    • Mitochondrial function and requirements change dramatically during development

    • Different cell types may show distinct dependencies on Complex II activity

    • The balance between glycolysis and oxidative phosphorylation shifts during transitions

  • Technical considerations:

    • Different methodologies may measure distinct aspects of sdhd function

    • Sample preparation can affect mitochondrial integrity and measurements

    • Resolution limitations (whole embryo vs. tissue-specific vs. single-cell)

  • Analytical approaches:

    • Perform time-course analyses with tight temporal resolution

    • Use multiple complementary methods to evaluate sdhd function

    • Implement tissue-specific or even single-cell approaches when possible

    • Consider the unilateral CRISPR approach in X. tropicalis to create internal controls

  • Biological complexity:

    • Compensatory mechanisms may mask primary effects of sdhd dysfunction

    • Metabolic flexibility allows embryos to adapt to perturbations

    • Redundancy from other dehydrogenases may contribute to phenotypic variability

When encountering conflicting data, a systematic approach that integrates multiple methodologies and considers developmental context will yield the most robust interpretation of sdhd function.

What emerging technologies and approaches are likely to advance our understanding of sdhd function in the future?

Several cutting-edge approaches hold promise for deeper insights into sdhd biology:

  • Single-cell technologies:

    • Single-cell transcriptomics to identify cell type-specific responses to sdhd manipulation

    • Single-cell metabolomics to detect metabolic heterogeneity within tissues

    • Spatial transcriptomics to map metabolic zonation within developing organs

  • Advanced imaging:

    • Super-resolution microscopy to visualize mitochondrial ultrastructure

    • Genetically encoded metabolic sensors for real-time visualization of metabolite levels

    • Correlative light and electron microscopy to link function and structure

  • Systems biology approaches:

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

    • Computational modeling of metabolic networks

    • Machine learning to identify patterns in complex datasets

  • Genetic technologies:

    • Base editing for precise introduction of specific mutations

    • Inducible and reversible gene manipulation systems

    • Multiplexed CRISPR screens to identify genetic interactions

  • Translational applications:

    • Patient-derived variant modeling in X. tropicalis

    • High-throughput drug screening using X. tropicalis embryos

    • Comparative studies across model organisms to identify conserved mechanisms

These emerging approaches, combined with the established advantages of X. tropicalis as a model system, will continue to advance our understanding of sdhd function in development, regeneration, and disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.