Recombinant Xenopus tropicalis Surfeit locus protein 1 (surf1)

Shipped with Ice Packs
In Stock

Description

Functional Domains and Evolutionary Conservation

Surf1 belongs to a conserved family of mitochondrial proteins involved in COX assembly. Key features include:

  • Membrane Localization: Tightly bound to the inner mitochondrial membrane .

  • Heme a Binding: Bacterial homologs (e.g., Paracoccus denitrificans Surf1c/q) bind heme a via conserved histidine residues, suggesting a role in cofactor delivery for COX biogenesis .

  • Species-Specific Roles: While human SURF1 mutations cause Leigh syndrome (COX deficiency), Xenopus surf1 is implicated in developmental signaling through mitochondrial metabolism .

COX Assembly and Metabolic Regulation

Surf1 is essential for COX assembly, particularly in stabilizing early intermediates (e.g., subunits I and IV) and ensuring proper heme a insertion . In Xenopus, surf1 depletion disrupts mitochondrial leak metabolism, which decouples oxidative phosphorylation from ATP synthesis. This process activates hypoxia-inducible factor-1α (Hif-1α) in the Spemann-Mangold Organizer (SMO), a critical signaling center during embryogenesis .

Key Findings from Xenopus Studies

ObservationMechanismSource
Increased Oxygen Consumption in SMOMitochondrial respiration in dorsal mesoderm exceeds ventral regions by ~20%
Hif-1α ActivationEctopic Hif-1α expression rescues SMO gene expression in β-catenin-inhibited embryos
Role in Wnt/β-Catenin SignalingHif-1α indirectly activates Wnt reporters, bypassing β-catenin dependency

Disease Associations and Evolutionary Insights

While Xenopus surf1 has not been directly linked to disease, its human homolog (SURF1) is a causative gene for Leigh syndrome, a fatal neurodegenerative disorder characterized by COX deficiency . Structural studies of bacterial Surf1 homologs reveal conserved heme a-binding motifs, underscoring a universal role in COX cofactor assembly .

Common Applications

ApplicationDetailsSource
SDS-PAGEPurity assessment (>90% confirmed via electrophoresis)
Western BlottingDetection using anti-His tag or surf1-specific antibodies
Functional StudiesAnalysis of COX assembly defects in surf1-depleted Xenopus embryos

Experimental Considerations

  • Reconstitution: Dissolve in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for storage .

  • Stability: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your desired tag type for preferential development.
Synonyms
surf1; Surfeit locus protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-307
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
surf1
Target Protein Sequence
MALPGVTKLLLLPGVRAQLLNTPVRLSHWATPGRCTKSCHAYLQKNLRFCTTRSFSSVSP AAESSEDTVLKWLLLLIPVATFSLGTWQVQRRSWKLKLIQEMEARVSGKPIPLTTDPMEI KELEYRPVKVRGHFDHSKELYILPRTLVDPEREAREAGQLASNTQSGAQVITPFYCSDLG ITILVNRGFVPKKKVNPETRPKGQVSGEVELVGIVRLNETRKPFVPHNDPSRNLWHYKDL SAMAQVVGAEPILIDADRGSTVPGGPIGGQTRVTLRNEHMQYIVTWYGLCAATTYLWCKK FIRKVAL
Uniprot No.

Target Background

Function
May play a role in mitochondrial respiratory chain complex IV assembly and is likely involved in COX complex biogenesis.
Database Links
Protein Families
SURF1 family
Subcellular Location
Mitochondrion inner membrane.

Q&A

What is the biological significance of Xenopus tropicalis Surfeit locus protein 1 (surf1)?

The Surfeit locus protein 1 (surf1) in Xenopus tropicalis plays a critical role in cellular respiration, particularly in the assembly of cytochrome c oxidase (COX), a key enzyme in the mitochondrial electron transport chain. This protein is essential for proper mitochondrial function, which is vital for energy production in eukaryotic cells. Studies on surf1 have revealed its involvement in maintaining mitochondrial integrity and its potential links to human diseases, such as Leigh syndrome, when homologous genes are mutated . The evolutionary conservation of surf1 across species makes Xenopus tropicalis an ideal model organism to study its function and regulation.

Why is Xenopus tropicalis a preferred model organism for studying surf1?

Xenopus tropicalis, a diploid amphibian species, offers several advantages for genetic and developmental studies. Unlike its tetraploid relative Xenopus laevis, X. tropicalis has a simpler genome that is more syntenic with mammalian genomes, facilitating comparative studies . The availability of its fully sequenced genome and advanced genetic tools, such as CRISPR/Cas9 and transgenesis techniques, allows researchers to manipulate genes like surf1 with precision. Additionally, the rapid development and ease of obtaining large numbers of embryos make X. tropicalis an efficient system for studying gene function during development .

How can recombinant surf1 protein be expressed and purified for experimental studies?

Recombinant surf1 protein from Xenopus tropicalis can be expressed using bacterial systems such as Escherichia coli. For instance, the full-length surf1 protein (amino acids 1-307) fused with an N-terminal His-tag has been successfully expressed in E. coli. The purification process typically involves affinity chromatography using nickel-nitrilotriacetic acid (Ni-NTA) resin to isolate His-tagged proteins . The purified protein can then be analyzed using SDS-PAGE to confirm its purity (>90%) and integrity . Proper storage conditions, such as lyophilization with stabilizing agents like trehalose and glycerol, are crucial to maintain protein functionality .

What are the challenges associated with studying recombinant surf1 protein?

One major challenge in studying recombinant surf1 protein is ensuring its proper folding and functionality after expression in heterologous systems like E. coli. As surf1 is a mitochondrial membrane-associated protein, it may require specific lipid environments or chaperones for correct folding. Another challenge is achieving high yields of soluble protein without aggregation. Researchers often optimize expression conditions, such as temperature and induction time, or use co-expression systems with molecular chaperones to address these issues. Additionally, functional assays to validate the activity of recombinant surf1 remain complex due to its role in COX assembly .

How does surf1 contribute to mitochondrial function?

Surf1 is primarily involved in the assembly and stabilization of cytochrome c oxidase (COX), which catalyzes the final step of oxidative phosphorylation by reducing oxygen to water . Mutations or dysfunctions in surf1 can lead to defective COX assembly, resulting in impaired mitochondrial respiration and reduced ATP production. This disruption has been implicated in various mitochondrial disorders, highlighting the importance of surf1 in cellular energy metabolism .

What experimental approaches can be used to study surf1 gene expression?

Studying the expression of the surf1 gene involves several molecular biology techniques:

  • Quantitative PCR (qPCR): This method quantifies mRNA levels of surf1 under different experimental conditions or developmental stages.

  • In situ hybridization: This technique localizes surf1 mRNA within tissues or embryos, providing spatial expression patterns.

  • Western blotting: Protein levels can be measured using antibodies specific to surf1.

  • Reporter assays: Promoter regions of the surf1 gene can be cloned upstream of reporter genes like GFP or luciferase to study transcriptional regulation.

  • CRISPR/Cas9-mediated knockouts: Functional studies can be performed by disrupting the surf1 gene and analyzing phenotypic consequences .

What are the implications of surf1 mutations in human diseases?

Mutations in the human homolog of surf1 are associated with Leigh syndrome, a severe neurodegenerative disorder characterized by progressive loss of mental and motor abilities due to mitochondrial dysfunction . These mutations often result in reduced COX activity, leading to energy deficits in affected tissues. Studying surf1 in model organisms like Xenopus tropicalis provides insights into the molecular mechanisms underlying these pathologies and potential therapeutic targets.

How can researchers design experiments to study the functional domains of surf1?

To dissect the functional domains of surf1, researchers can use site-directed mutagenesis to generate specific amino acid substitutions or deletions within conserved regions. These mutant constructs can then be expressed recombinantly to assess their impact on COX assembly or interaction with other mitochondrial proteins. Structural studies using techniques like X-ray crystallography or cryo-electron microscopy may also reveal domain-specific roles. Functional assays, such as measuring oxygen consumption rates or ATP production in cells expressing mutant proteins, provide further insights into domain functionality .

Are there any known post-translational modifications (PTMs) of surf1?

Post-translational modifications (PTMs) play crucial roles in regulating protein function and stability. While specific PTMs of Xenopus tropicalis surf1 have not been extensively characterized, homologous studies suggest potential phosphorylation sites that may influence its activity or interactions within mitochondria. Mass spectrometry-based proteomics can be employed to identify PTMs on recombinant or native proteins under different physiological conditions.

How does genetic manipulation of surf1 affect embryonic development in Xenopus tropicalis?

Genetic manipulation of surf1 using tools like CRISPR/Cas9 or morpholino antisense oligonucleotides allows researchers to study its role during embryogenesis. Knockdown or knockout of surf1 often results in developmental defects due to impaired mitochondrial function, highlighting its importance in energy-demanding processes like cell division and differentiation . Rescue experiments with wild-type or mutant constructs can further elucidate its developmental roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.