Recombinant Xenopus tropicalis T-cell leukemia translocation-altered gene protein homolog (tcta)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus tropicalis TCTA

The recombinant Xenopus tropicalis T-cell leukemia translocation-altered gene protein homolog (TCTA) is a synthetic version of the TCTA protein, expressed in Escherichia coli with an N-terminal His tag. This protein is derived from the tcta gene, which is conserved across species from Drosophila to humans . The recombinant form is utilized in research to study its role in cellular processes, including leukemia-related pathways and osteoclastogenesis .

Table 2: Gene Information for tcta in Xenopus tropicalis

AttributeDetailSource
Gene Nametcta (T-cell leukemia translocation-altered)
Entrez Gene ID100124829
Full NameT-cell leukemia translocation-altered gene protein homolog
OrganismXenopus tropicalis (Western clawed frog)
UniProt IDA4IHD1

The tcta gene encodes a 102-amino-acid protein with no strong homology to previously reported proteins but shares evolutionary conservation with TCTA orthologs in humans and other vertebrates .

Applications in Research

The recombinant TCTA protein serves as a tool for studying:

  1. Protein Interactions: Investigating binding partners, such as SMAD4, to elucidate signaling pathways .

  2. Osteoclastogenesis: Analogous to human TCTA, which regulates bone resorption via peptide derivatives .

  3. Leukemia Models: Leveraging Xenopus tropicalis as a diploid model organism for hematologic malignancies .

Table 3: Related Recombinant TCTA Proteins

SpeciesProduct CodeTag/FeaturesSource
Xenopus tropicalisRFL17996XFHis-tagged, E. coli-expressed
HumanEB-EPE8414945His or DYKDDDDK tags
MouseTCTA-221MMYC/DDK-tagged
RatTCTA-5654RHis (Fc)-Avi-tagged

Evolutionary Conservation

Phylogenetic analysis reveals moderate identity (38.19%) between protozoan TCTP orthologs and human TCTP, with conserved residues critical for GTPase activation (e.g., E123) . Xenopus TCTA’s sequence conservation supports its utility in cross-species studies .

Challenges and Future Directions

  • Structural Analysis: Limited 3D structural data for Xenopus TCTA compared to human TCTA .

  • Functional Validation: Testing the recombinant protein’s role in Xenopus leukemia models remains an open area .

Product Specs

Form
Lyophilized powder
Note: While we preferentially ship the format we have in stock, we are happy to accommodate specific format requests. Please indicate your requirements when placing the order, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging this vial briefly prior to opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize its development for your request.
Synonyms
tcta; T-cell leukemia translocation-altered gene protein homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tcta
Target Protein Sequence
MAETWGSEIMTQALGCLQAFSSEFALEWENSDMKAAIFKLLLGWIVLSLTAIHLAWKSYG PTVNSIYYRQGMGGQNGGTPEYPARFPIWESSSTESLKRHQE
Uniprot No.

Target Background

Database Links
Protein Families
TCTA family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is TCTA protein and what is its evolutionary significance?

TCTA (T-cell leukemia translocation-altered gene protein) is a highly conserved protein that has been maintained throughout evolution in organisms ranging from Drosophila to humans. In Xenopus tropicalis, TCTA consists of 102 amino acid residues with a molecular weight of approximately 11.3 kDa. The conservation across species suggests fundamental biological importance, though its precise evolutionary significance remains under investigation. The high degree of conservation indicates potential roles in basic cellular functions that have been maintained throughout vertebrate evolution . When studying this protein, researchers should consider its evolutionary context to better understand functional implications in various model systems.

How does TCTA protein expression in Xenopus compare to human TCTA expression patterns?

While human TCTA mRNA is expressed ubiquitously across tissues with highest levels in the kidney, Xenopus tropicalis TCTA expression patterns show important developmental regulation. Research indicates that TCTA is expressed throughout Xenopus embryonic development with potential temporal regulation during key developmental stages. The conservation between human and Xenopus TCTA suggests similar functional roles, but researchers should account for potential species-specific differences in expression patterns when designing comparative studies . RT-PCR and in-situ hybridization methods are recommended for precise characterization of expression patterns across developmental stages.

What are the optimal storage and reconstitution conditions for recombinant Xenopus tropicalis TCTA protein?

The recombinant Xenopus tropicalis TCTA protein should be stored at -20°C/-80°C upon receipt. For optimal stability, aliquoting is necessary to minimize freeze-thaw cycles, which can compromise protein integrity. The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being optimal) before aliquoting and storing at -20°C/-80°C . When designing experiments, researchers should account for potential activity loss during freeze-thaw cycles by preparing single-use aliquots and maintaining working stocks at 4°C for no longer than one week.

How can researchers verify the purity and functionality of recombinant Xenopus tropicalis TCTA protein?

Verification of recombinant Xenopus tropicalis TCTA protein purity can be performed via SDS-PAGE analysis, which should show >90% purity as a single band corresponding to approximately 11.3 kDa. For functionality assessment, researchers should consider:

  • Protein-protein interaction assays to validate binding to known partners like SMAD4

  • Cell-based assays examining effects on osteoclastogenesis

  • Western blot verification using anti-His antibodies (for His-tagged protein)

  • Mass spectrometry for sequence verification

Functional assessment should include both positive and negative controls to ensure that observed effects are specific to TCTA activity . Given TCTA's reported role in preventing cellular fusion during osteoclastogenesis, cell fusion assays provide a practical functional readout.

What expression systems are optimal for producing functional recombinant Xenopus tropicalis TCTA protein?

E. coli expression systems have been successfully employed for producing full-length recombinant Xenopus tropicalis TCTA protein. The protein is typically expressed with an N-terminal His-tag to facilitate purification. For experiments requiring post-translational modifications, researchers should consider eukaryotic expression systems such as insect cells or mammalian cell lines, though these systems may reduce yield. When designing expression constructs, researchers should account for codon optimization for the selected expression system and consider the impact of fusion tags on protein folding and activity . Comparative analysis of protein produced in different expression systems may be necessary to ensure physiological relevance of experimental findings.

How can Xenopus tropicalis TCTA protein be utilized in developmental toxicity studies?

Xenopus tropicalis provides an excellent model for developmental toxicity studies through the Frog Embryo Teratogenesis Assay-Xenopus (FETAX). When incorporating TCTA protein in these studies, researchers should:

  • Design experiments that examine TCTA expression changes in response to toxicants

  • Explore TCTA protein function disruption as a potential mechanism of developmental toxicity

  • Consider TCTA knockdown or overexpression to determine its role in developmental processes

The FETAX assay provides multiple endpoints including mortality (LC50), malformation rates (EC50), growth parameters, and developmental stage progression over a 96-hour period . Researchers can incorporate TCTA-specific analyses within this framework to determine if developmental toxicants impact TCTA expression or function, potentially revealing novel mechanisms of teratogenicity.

What is the role of TCTA in osteoclastogenesis and how can this be studied using Xenopus models?

Research has demonstrated that TCTA protein inhibits human osteoclastogenesis by preventing cellular fusion via interaction with a putative counterpart molecule. To study this in Xenopus models, researchers could:

  • Examine TCTA expression during skeletal development in Xenopus

  • Use morpholino oligonucleotides to knockdown TCTA expression and assess effects on osteoclast formation

  • Perform rescue experiments with recombinant TCTA protein

  • Identify potential TCTA-interacting proteins in Xenopus development through co-immunoprecipitation studies

The high conservation of TCTA suggests its function in osteoclastogenesis may be preserved across species, making Xenopus a valuable model for studying basic mechanisms of bone resorption regulation . When designing such experiments, researchers should consider developmental timing and tissue-specific expression patterns of TCTA.

How does TCTA protein relate to cancer research and what methodology is appropriate for studying this relationship?

TCTA was originally identified at the site of a t(1;3)(p34;p21) translocation breakpoint in T-cell acute lymphoblastic leukemia. Additionally, genomic Southern blots have demonstrated reduced TCTA signal in three of four small cell lung cancer cell lines, suggesting loss of one copy of the gene. To investigate TCTA's role in cancer using Xenopus models, researchers should:

  • Examine effects of TCTA overexpression or knockdown on cell proliferation and apoptosis in Xenopus embryos

  • Study TCTA protein interactions with known cancer-related proteins like SMAD4

  • Perform comparative genomic analyses of TCTA between Xenopus and human cancer cell lines

  • Utilize Xenopus embryos for screening compounds that modulate TCTA expression or function

Appropriate methodologies include CRISPR/Cas9-mediated genome editing, RNA-seq for expression profiling, and protein-protein interaction studies . The amphibian model provides advantages for initial screening and mechanistic studies that can later be translated to mammalian models.

What are the technical challenges in studying TCTA protein-protein interactions, and how can these be overcome in Xenopus systems?

Studying TCTA protein-protein interactions presents several technical challenges:

  • The small size of TCTA (102 amino acids) makes traditional pull-down assays difficult

  • Limited availability of Xenopus-specific antibodies against TCTA

  • Potential transient nature of interactions

  • Limited knowledge of binding domains within TCTA

To overcome these challenges, researchers can employ:

  • BioID or APEX proximity labeling to identify interaction partners in vivo

  • Split-GFP complementation assays for validating specific interactions

  • Yeast two-hybrid screening using Xenopus cDNA libraries

  • Crosslinking mass spectrometry to capture transient interactions

The reported interaction between TCTA and SMAD4 provides a starting point for developing positive controls . When designing interaction studies, researchers should consider the subcellular localization of TCTA to ensure physiologically relevant conditions.

How can contradictory findings regarding TCTA function be reconciled through experimental design?

Researchers may encounter contradictory findings regarding TCTA function across different model systems or experimental conditions. To address such contradictions:

  • Perform comprehensive dose-response studies using recombinant TCTA protein

  • Examine temporal aspects of TCTA function through time-course experiments

  • Consider tissue-specific or developmental stage-specific effects

  • Validate findings using multiple methodological approaches (e.g., genetic knockdown, protein inhibition, overexpression)

  • Account for potential differences between in vitro and in vivo systems

For example, while TCTA inhibits osteoclastogenesis in human systems, its role in Xenopus development may involve additional functions. Careful experimental design with appropriate controls and multiple methodological approaches can help reconcile apparently contradictory findings . Statistical analysis should include power calculations to ensure sufficient sample sizes for detecting biological effects.

What is the relationship between TCTA and SMAD4, and how can this be investigated using recombinant Xenopus tropicalis TCTA?

TCTA has been reported to interact with SMAD4 in a proteome-scale map of human protein-protein interactions. To investigate this relationship using recombinant Xenopus tropicalis TCTA:

  • Perform co-immunoprecipitation experiments with tagged recombinant TCTA and Xenopus SMAD4

  • Map interaction domains through truncation mutants

  • Examine functional consequences of the interaction on TGF-β signaling

  • Investigate developmental contexts where both proteins are co-expressed

Since SMAD4 is a critical mediator of TGF-β signaling, this interaction may implicate TCTA in developmental processes regulated by this pathway . Researchers should design experiments that not only confirm the physical interaction but also elucidate its functional significance in relevant biological contexts.

What genomic approaches can be used to study TCTA gene regulation in Xenopus tropicalis?

Advanced genomic approaches for studying TCTA gene regulation include:

  • ChIP-seq to identify transcription factors binding to the TCTA promoter

  • ATAC-seq to characterize chromatin accessibility around the TCTA locus

  • CUT&RUN or CUT&TAG for high-resolution mapping of protein-DNA interactions

  • Single-cell RNA-seq to define cell type-specific expression patterns

  • CRISPR interference or activation to modulate TCTA expression

These approaches can reveal regulatory mechanisms controlling TCTA expression during development or in response to environmental stimuli . When designing such experiments, researchers should consider developmental timing and potential tissue-specific regulatory mechanisms.

How can structural biology approaches enhance our understanding of Xenopus tropicalis TCTA protein function?

Despite the small size of TCTA protein, structural biology approaches can provide valuable insights into its function:

  • X-ray crystallography or NMR spectroscopy of purified recombinant TCTA

  • Cryo-EM of TCTA complexes with interaction partners

  • Hydrogen-deuterium exchange mass spectrometry to identify flexible regions

  • Molecular dynamics simulations based on predicted or experimentally determined structures

  • Structure-guided mutagenesis to test functional hypotheses

These approaches can reveal binding interfaces, conformational changes, and structure-function relationships . Given TCTA's size, NMR spectroscopy may be particularly suitable for structural determination, potentially revealing functional domains that could be targeted in future studies.

What are the implications of TCTA research for understanding human diseases, and how can Xenopus models contribute?

TCTA research has implications for multiple human diseases:

  • T-cell acute lymphoblastic leukemia, where TCTA was first identified

  • Small cell lung cancer, where loss of one TCTA allele has been observed

  • Rheumatoid arthritis, where TCTA peptides inhibit osteoclastogenesis

  • Potential roles in developmental disorders due to TCTA's evolutionary conservation

Xenopus models can contribute through:

  • High-throughput screening of compounds that modulate TCTA function

  • Rapid assessment of TCTA mutations identified in human patients

  • Detailed characterization of developmental pathways involving TCTA

  • Testing therapeutic approaches targeting TCTA or its interaction partners

The FETAX assay provides a validated platform for studying developmental toxicity that can be adapted to investigate TCTA's role in human diseases . Researchers should design translational studies that bridge findings from Xenopus models to human disease contexts through comparative genomics and functional validation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.