Recombinant Xenopus tropicalis Threonylcarbamoyladenosine tRNA methylthiotransferase (cdkal1)

Shipped with Ice Packs
In Stock

Description

Functional Role in tRNA Modification

CDKAL1 catalyzes the methylthiolation of N<sup>6</sup>-threonylcarbamoyladenosine (t<sup>6</sup>A<sup>37</sup>) in tRNA<sup>Lys3</sup>, producing ms<sup>2</sup>t<sup>6</sup>A<sup>37</sup>. This modification:

  • Enhances translational fidelity by stabilizing codon-anticodon interactions .

  • Ensures accurate lysine incorporation at AAG/AAA codons in proinsulin mRNA .

  • Deficiency leads to mistranslation, impaired insulin processing, and β-cell dysfunction .

Impact on Insulin Secretion

  • Knockout (KO) models: Cdkal1<sup>-/-</sup> mice exhibit reduced first-phase insulin exocytosis due to blunted ATP production in pancreatic β-cells .

  • Human studies: SNPs in CDKAL1 correlate with decreased first-phase insulin release and increased type 2 diabetes (T2D) risk .

Mechanistic Insights

  • ATP generation: CDKAL1 deficiency reduces mitochondrial ATP synthesis, impairing glucose-stimulated K<sub>ATP</sub> channel closure and Ca<sup>2+</sup> influx .

  • tRNA fidelity: Loss of ms<sup>2</sup>t<sup>6</sup>A<sup>37</sup> modification causes mistranslation at lysine codons, leading to improper proinsulin cleavage .

Applications in Biomedical Research

Recombinant X. tropicalis CDKAL1 is utilized for:

  • Enzymatic assays: Characterizing methylthiotransferase kinetics and Fe-S cluster dependency .

  • Disease modeling: Studying tRNA modification defects in T2D pathogenesis .

  • Comparative studies: Evolutionary analysis of CDKAL1 orthologs across species .

Table 2: Functional Outcomes of CDKAL1 Silencing

Model SystemObserved DefectCitation
Drosophila melanogasterLethality in homozygous mutants
MIN6 β-cells80% reduction in mature insulin production
Human isletsImpaired glucose-stimulated insulin secretion

Technical Considerations

  • Expression challenges: Recombinant CDKAL1 requires optimized Fe-S cluster assembly for activity .

  • Assay compatibility: Compatible with MALDI-TOF mass spectrometry for tRNA modification analysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
cdkal1; Threonylcarbamoyladenosine tRNA methylthiotransferase; CDK5 regulatory subunit-associated protein 1-like 1; tRNA-t(6A37 methylthiotransferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-553
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
cdkal1
Target Protein Sequence
MPAACESLLDDIEDIVSATDPKPHDRQNARQNIVPRARKRNKNKIQEEEPPADSTIPGTQ KIWIRTWGCSHNNSDGEYMAGQLAAYGYSITEQPEQADLWLLNSCTVKSPAEDHFRNSIK KAQEANKKVVLSGCVPQAQPRQEYMKGLSIIGVQQIDRVVEVVEETIKGHSVRLLGQKKD NGKRLGGARLDLPKIRKNPLIEIISINTGCLNACTYCKTKHARGELASYPVEELVDRAAQ SFQEGVCEIWLTSEDTGAYGRDIGTDLPTLLWKLVEVIPEGAMLRLGMTNPPYILEHLEE MAKILNHPRVYAFLHIPVQSASDSVLMDMKREYCIADFKRVVDFLKERVPGITIATDIIC GFPGETDEDFKETLKLVEEYKFPSLFINQFYPRPGTPAAKMEQVPAHVKKQRTKELSQLF HSYSPYDHKIGEEQHVLVTEESFDSQYYVSHNRFYEQVLVPKDPAFVGKMVEVKIFEAGK HFMKGQPVQDSYIYTPSITKPLAKGEVSGLTEESKPPNNPESLLQTSREGLQTFFFVTAL LAAVIAFVGIKLL
Uniprot No.

Target Background

Function

This enzyme catalyzes the methylthiolation of N6-threonylcarbamoyladenosine (t6A), resulting in the formation of 2-methylthio-N6-threonylcarbamoyladenosine (ms2t6A) at position 37 in tRNAs that recognize codons beginning with adenine.

Database Links
Protein Families
Methylthiotransferase family, CDKAL1 subfamily
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is the primary function of Xenopus tropicalis CDKAL1?

Xenopus tropicalis CDKAL1 functions as a methylthiotransferase (MTTase) that catalyzes the specific transformation of N6-threonylcarbamoyladenosine (t6A) into 2-methylthio-N6-threonylcarbamoyladenosine (ms2t6A) in tRNA molecules. This modification occurs at position 37 (A37) of the tRNA, which is directly adjacent to the 3'-end of the anticodon. The modified nucleoside is essential for ensuring efficient and highly accurate protein translation by the ribosome. CDKAL1 belongs to the e-MtaB subfamily of methylthiotransferases that are found predominantly in eukaryotic organisms and archaebacteria . This enzyme plays a critical role in maintaining translational fidelity, with implications for proper protein production throughout the organism's development and cellular functions.

How is the domain architecture of CDKAL1 organized?

The domain architecture of CDKAL1 follows the characteristic structure of radical S-adenosylmethionine (AdoMet) methylthiotransferases, consisting of three distinct functional domains. The N-terminal domain contains a UPF0004 domain with three invariant cysteines in the CX34–36CX28–37C motif. The central region houses the radical AdoMet domain containing three invariant cysteines in the CX3CX2C motif, which is critical for the enzyme's catalytic activity. The C-terminal region features a TRAM domain, which is likely involved in RNA binding and substrate recognition . This three-domain architecture is conserved across different MTTase families, including MiaB and RimO, suggesting evolutionary relationships among these enzymes that catalyze similar biochemical reactions despite targeting different substrates.

What evolutionary relationships exist between CDKAL1 and bacterial methylthiotransferases?

Phylogenomic analyses reveal that CDKAL1 belongs to the e-MtaB subfamily of methylthiotransferases with evolutionary connections to bacterial MtaB enzymes (such as YqeV in Bacillus subtilis). These relationships were established through PSI-BLAST profiles and sequence similarity analyses across 474 bacterial genomes and the human genome. The analysis identified five distinct sequence families of radical AdoMet MTTases, including the well-characterized MiaB and RimO enzyme families . The evolutionary conservation of these enzymes underscores their biological importance in RNA modification pathways across diverse species. The e-MtaB subfamily (including CDKAL1) is found in higher eukaryotes and archaebacteria, while the MtaB subfamily exists primarily in bacterial species, suggesting divergent evolution from a common ancestral enzyme while maintaining similar biochemical functions.

What are recommended methods for cloning and expressing recombinant Xenopus tropicalis CDKAL1?

For successful cloning and expression of recombinant Xenopus tropicalis CDKAL1, researchers should consider adapting methods used for related MTTases. Based on protocols for bacterial MTTases, the following approach is recommended: First, PCR-amplify the full-length CDKAL1 open reading frame using high-fidelity DNA polymerase with primers containing appropriate restriction sites (similar to the SmaI and XhoI sites used for mouse CDKAL1) . The amplified fragment should be gel-purified and cloned into an expression vector such as pGEX6P-1 for GST-tagged protein production. For bacterial expression, E. coli BL21CodonPlus(DE3)-RIL is an appropriate host strain, with induction using 100 μM IPTG at 30°C rather than 37°C to enhance proper protein folding. It is crucial to supplement the growth medium with iron and sulfur sources to support [4Fe-4S] cluster formation. Protein expression should be monitored by SDS-PAGE analysis of pre- and post-induction samples.

What purification strategies yield active CDKAL1 protein?

Purification of active CDKAL1 requires anaerobic techniques to preserve the iron-sulfur clusters essential for enzyme activity. Based on successful protocols for bacterial MTTases like YqeV, the following multi-step purification strategy is recommended: First, harvest cells and perform cell lysis preferably under anaerobic conditions in a glove box. The cell lysate should be clarified by high-speed centrifugation (220,000 × g) to remove cellular debris . For GST-tagged CDKAL1, use glutathione-Sepharose affinity chromatography with careful buffer optimization to include stabilizing agents (5-10% glycerol) and reducing agents (dithiothreitol or β-mercaptoethanol). Following affinity purification, consider size-exclusion chromatography to isolate homogeneous protein. Throughout purification, minimize exposure to oxygen by degassing all buffers and maintaining an anaerobic environment when possible. Purified protein should appear brownish, indicating the presence of iron-sulfur clusters, and UV-visible spectroscopy should show characteristic absorption peaks at approximately 320 and 420 nm.

How can the activity of recombinant CDKAL1 be assayed in vitro?

In vitro activity assays for CDKAL1 should measure the conversion of t6A to ms2t6A in tRNA substrates. A comprehensive assay system would include: purified CDKAL1 enzyme, substrate tRNA (either total tRNA extract or in vitro transcribed specific tRNAs that decode ANN codons), S-adenosylmethionine as methyl donor, sodium dithionite as reductant, and a suitable buffer system maintained at pH 7.0-8.0 . After incubation at 37°C for 30-60 minutes, the reaction products should be analyzed by nucleoside HPLC coupled with mass spectrometry (HPLC/MS) to detect and quantify ms2t6A formation. For HPLC analysis, tRNA should be digested to nucleosides using nuclease P1 and bacterial alkaline phosphatase treatment . Control reactions lacking enzyme or S-adenosylmethionine are essential to verify enzyme-dependent modification. This approach provides quantitative assessment of enzyme activity and can be used to determine kinetic parameters such as Km and kcat for substrate tRNAs.

How do the [4Fe-4S] clusters function in CDKAL1 catalysis?

CDKAL1, similar to other MTTases including bacterial YqeV, contains two [4Fe-4S] clusters that are essential for its catalytic mechanism . The first [4Fe-4S] cluster is located in the radical S-adenosylmethionine (SAM) domain and is coordinated by the characteristic CX3CX2C motif. This cluster is responsible for the reductive cleavage of SAM to generate a 5'-deoxyadenosyl radical intermediate. The second [4Fe-4S] cluster, found in the N-terminal UPF0004 domain and coordinated by the CX34–36CX28–37C motif, is believed to bind and activate the sulfur source required for the methylthiolation reaction. The radical mechanism likely proceeds through hydrogen atom abstraction from the substrate by the 5'-deoxyadenosyl radical, followed by thiolation and methylation steps. Site-directed mutagenesis of the conserved cysteine residues in the CX3CX2C motif abolishes enzyme activity, confirming the essential role of these iron-sulfur clusters in catalysis .

What mechanisms underlie substrate recognition by CDKAL1?

CDKAL1 exhibits specific recognition of tRNAs containing t6A at position 37, particularly those decoding ANN codons. Substrate recognition involves multiple determinants: First, the C-terminal TRAM domain likely mediates RNA binding through interactions with the anticodon stem-loop structure of the tRNA. Second, the enzyme must recognize the precise chemical structure of the t6A modification as its substrate. The binding specificity may involve key amino acid residues that form hydrogen bonds with the threonylcarbamoyl group of t6A. Additionally, the three-dimensional structure of the tRNA, particularly the anticodon loop conformation, plays a crucial role in positioning the t6A37 residue in the enzyme's active site. Comparative analysis with bacterial MtaB enzymes suggests that despite sequence divergence between eukaryotic and prokaryotic enzymes, the substrate recognition mechanisms are conserved, reflecting the fundamental importance of accurate tRNA modification in translation across all domains of life .

How does CDKAL1-mediated tRNA modification influence translation fidelity?

The ms2t6A modification catalyzed by CDKAL1 at position 37 of tRNAs significantly enhances translation fidelity through several mechanisms. This hypermodification strengthens codon-anticodon interactions by improving base stacking between the anticodon and the modified nucleoside. The 2-methylthio group enhances the rigidity of the anticodon loop structure, which reduces frameshifting errors during translation. Additionally, the modification facilitates proper decoding of A-ending codons by stabilizing the first position codon-anticodon interaction . This becomes particularly important for accurately distinguishing between codons differing in their third position (wobble position). The absence of ms2t6A modification can lead to increased translation errors, resulting in protein misfolding or altered protein functionality. In cellular contexts, CDKAL1 deficiency potentially impacts the translation of specific mRNAs that rely heavily on the affected tRNAs, which may explain the tissue-specific phenotypes observed in CDKAL1-related diseases.

What is the evidence linking CDKAL1 variants to type 2 diabetes?

Genetic polymorphisms in the human CDKAL1 gene have been strongly associated with increased risk of developing type 2 diabetes . The mechanistic connection likely involves CDKAL1's role in tRNA modification affecting translation fidelity. Several studies have demonstrated that CDKAL1 variants reduce insulin secretion from pancreatic β-cells, which compromises glucose homeostasis. At the molecular level, defective CDKAL1 activity may impair the accurate translation of specific proteins critical for β-cell function, such as proinsulin. Misfolded proinsulin can trigger endoplasmic reticulum stress, ultimately leading to β-cell dysfunction and reduced insulin production. The identification of CDKAL1 as a type 2 diabetes risk gene highlights the unexpected connection between tRNA modification, translation fidelity, and metabolic disease. This association underscores the potential importance of studying CDKAL1 function across different model organisms, including Xenopus tropicalis, to better understand the fundamental mechanisms linking RNA modification to human disease.

How can CDKAL1 knockout models advance our understanding of its physiological roles?

Developing CDKAL1 knockout models in Xenopus tropicalis and other organisms provides powerful tools for elucidating the physiological roles of this methylthiotransferase. CRISPR-Cas9 genome editing can be employed to generate complete or conditional CDKAL1 knockout animals. These models allow researchers to examine the consequences of CDKAL1 deficiency at multiple levels: molecular (altered tRNA modification profiles), cellular (translation fidelity and protein homeostasis), and organismal (developmental impacts and metabolic phenotypes). In Xenopus models, researchers can leverage the advantages of external development and large embryo size to track developmental consequences of CDKAL1 deficiency. Tissue-specific knockout approaches can help determine if CDKAL1 functions differently across tissue types, particularly in pancreatic tissue given its connection to diabetes. Additionally, these models enable "rescue experiments" where wild-type or mutant versions of CDKAL1 are reintroduced to determine which domains and activities are essential for its physiological functions. Such approaches would complement the biochemical studies of recombinant CDKAL1 with in vivo functional insights.

What comparative approaches can reveal functional differences between CDKAL1 orthologs?

Comparative analysis of CDKAL1 orthologs from different species can provide valuable insights into functional conservation and divergence. Multiple sequence alignment of CDKAL1 sequences from diverse eukaryotes (mammals, amphibians, fish, insects, etc.) can identify highly conserved regions likely critical for function versus more variable regions that may reflect species-specific adaptations. Phylogenetic analysis using methods similar to those described in the research literature, such as PSI-BLAST profiling and cladogram reconstruction using MEGA software , can establish evolutionary relationships among CDKAL1 orthologs and other MTTase families. Complementation assays testing the ability of CDKAL1 from different species to restore function in yeast or bacterial mutants lacking their native methylthiotransferase provide functional evidence of conservation. Additionally, biochemical characterization comparing substrate specificity, catalytic efficiency, and physical properties of CDKAL1 from different species can reveal functional adaptations. Such comparative approaches may identify species-specific features that could explain differential sensitivity to disease-associated mutations or environmental factors across evolutionary lineages.

What analytical techniques are most effective for detecting and quantifying ms2t6A modifications?

The gold standard for detecting and quantifying ms2t6A modifications in tRNA involves a combination of nucleoside preparation and chromatographic/mass spectrometric analysis. The recommended workflow begins with isolation of total tRNA from cells or tissues, followed by enzymatic digestion to individual nucleosides using nuclease P1 and bacterial alkaline phosphatase treatment . The resulting nucleoside mixture is then analyzed by high-performance liquid chromatography (HPLC) coupled to mass spectrometry (MS). HPLC separation typically employs a reverse-phase C18 column with appropriate mobile phases to resolve modified nucleosides. The characteristic UV absorption profile and mass-to-charge ratio of ms2t6A provide definitive identification. Tandem mass spectrometry (MS/MS) can further confirm the structure through fragmentation patterns. For accurate quantification, the use of stable isotope-labeled internal standards is recommended. This analytical approach can detect changes in ms2t6A levels resulting from genetic manipulation of CDKAL1 or cellular stress conditions, providing a direct measure of CDKAL1 activity in biological samples.

Analytical TechniqueApplicationAdvantagesLimitations
HPLC-UVInitial screening of nucleoside modificationsSimple setup, good for relative quantificationLimited specificity for complex modifications
HPLC-MSIdentification and quantification of ms2t6AHigh specificity, accurate mass determinationRequires specialized equipment
LC-MS/MSStructural confirmation and trace analysisHighest specificity, fragment informationComplex method development, expensive
2D-TLCAlternative separation methodAccessible technology, visual resultsLimited resolution, qualitative
Northern blotting with specific probesDetection of modified tRNAsCan analyze intact tRNAsLower sensitivity, indirect measurement

How can researchers overcome challenges in expressing and purifying active recombinant CDKAL1?

Expressing and purifying active recombinant CDKAL1 presents several challenges due to its complex structure containing iron-sulfur clusters. To overcome these challenges, researchers should consider the following strategies: First, use expression vectors with inducible promoters allowing fine control over expression levels, such as pGEX6P-1 for GST-tagged proteins . Second, optimize expression conditions by lowering induction temperature (28-30°C) and using lower IPTG concentrations (50-100 μM) to enhance proper protein folding. Third, supplement growth media with iron (ferrous ammonium sulfate) and sulfur sources (cysteine) to support [4Fe-4S] cluster assembly. Fourth, consider co-expression with iron-sulfur cluster assembly proteins (ISC or SUF system components) to enhance cluster incorporation. Fifth, perform all purification steps under anaerobic conditions in a glove box to prevent oxidation and degradation of the iron-sulfur clusters. Sixth, include stabilizing agents in all buffers (glycerol, reducing agents, and possibly low concentrations of substrate). Finally, verify the presence of intact iron-sulfur clusters using UV-visible spectroscopy and chemical reconstitution if necessary. These approaches significantly improve the likelihood of obtaining catalytically active enzyme suitable for biochemical and structural studies.

How might high-throughput methods advance CDKAL1 research?

High-throughput approaches offer promising avenues to accelerate CDKAL1 research across multiple dimensions. RNA sequencing technologies specifically analyzing tRNA modifications (such as tRNA-seq with demethylase treatment) can systematically map ms2t6A modifications across all tRNAs in different tissues and under various conditions. This would reveal the complete substrate profile of CDKAL1 and potential regulatory mechanisms. CRISPR-Cas9 screens targeting genes that interact with CDKAL1 could identify novel components of the tRNA modification pathway and regulatory networks. Ribosome profiling (Ribo-seq) in CDKAL1-deficient versus wild-type cells would reveal translation effects at codon-level resolution, identifying specific mRNAs whose translation is most affected by ms2t6A modification. Proteomic approaches can identify proteins that interact with CDKAL1, potentially revealing cofactors or regulatory partners. Metabolomic analysis could detect changes in cellular metabolism resulting from CDKAL1 dysfunction, particularly in pathways relevant to diabetes pathogenesis. Finally, high-throughput screening of small molecule libraries could identify inhibitors or activators of CDKAL1, providing valuable chemical probes for functional studies and potential therapeutic development for CDKAL1-associated diseases.

What are the unexplored aspects of CDKAL1 regulation in cellular physiology?

Several critical aspects of CDKAL1 regulation remain unexplored and represent promising areas for future research. The transcriptional and post-transcriptional regulation of CDKAL1 expression across different tissues and developmental stages is poorly understood. Potential regulation of CDKAL1 activity through post-translational modifications, protein-protein interactions, or allosteric mechanisms awaits investigation. The subcellular localization and potential compartmentalization of CDKAL1 activity, which might contribute to spatial regulation of tRNA modification, requires further study. The relationship between cellular iron-sulfur cluster biogenesis pathways and CDKAL1 activity presents an interesting regulatory node, particularly under oxidative stress conditions that may compromise iron-sulfur cluster integrity. Additionally, the potential coordination between CDKAL1 and other tRNA modification enzymes to ensure proper modification patterns remains largely unexplored. Understanding these regulatory mechanisms could reveal how cells modulate translation fidelity in response to changing physiological demands and environmental stresses, potentially offering new insights into disease mechanisms and therapeutic approaches for CDKAL1-associated conditions like type 2 diabetes.

How can interdisciplinary approaches enhance our understanding of CDKAL1 in disease contexts?

Interdisciplinary approaches integrating multiple research domains offer powerful strategies to elucidate CDKAL1's role in disease contexts. Combining structural biology with medicinal chemistry could lead to the development of small molecule modulators of CDKAL1 activity for use as research tools and potential therapeutics. Systems biology approaches integrating transcriptomics, proteomics, and metabolomics data from CDKAL1-deficient models could reveal the complex network effects of impaired tRNA modification. Clinical studies correlating CDKAL1 variants with detailed metabolic phenotyping and biomarker analysis in diabetes patients would strengthen the connection between basic science findings and human disease. Computational biology, including machine learning approaches applied to multi-omic datasets, could identify patterns and relationships not apparent through conventional analysis. Developmental biology perspectives using Xenopus and other model organisms can reveal how CDKAL1 functions during embryogenesis and organogenesis, potentially explaining the origins of disease susceptibility. Finally, translational research bridging basic CDKAL1 biology with clinical applications could lead to novel diagnostic approaches or therapeutic strategies targeting the tRNA modification pathway. These interdisciplinary approaches would collectively provide a comprehensive understanding of how this fundamental RNA modification enzyme contributes to human disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.