Recombinant Xenopus tropicalis TM2 domain-containing protein 2 (tm2d2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering. We will accommodate your request whenever possible.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tm2d2; TEgg137n19.1; TM2 domain-containing protein 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
28-198
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tm2d2
Target Protein Sequence
QNQTSPVTYPDLNLSAAPEPRDPLGPLVLCSYLPEEFVECDDPVDHMGNGTAQQELRYGC KKFGGQAYGDVEHTQVMCRALDGIECDGPRSFLRGNKPCIKYTGHYFITTLLYSFFLGCF GVDRFCLGHTGTAVGKLLTLGGLGIWWFVDLILLITGGLMPSDNSNWCTIY
Uniprot No.

Target Background

Database Links

KEGG: xtr:496785

UniGene: Str.22124

Protein Families
TM2 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.