Recombinant Xenopus tropicalis Transmembrane protein 129 (tmem129)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order remarks for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
tmem129; E3 ubiquitin-protein ligase TM129; RING-type E3 ubiquitin transferase TM129
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-362
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem129
Target Protein Sequence
EFHSAGITVQNLLSGWLGSEDVAFVHYHIRRSTATLLTHSLLPMGYFIGMCFAAPEKELY NVYKAADGWKVFVLITVLLPVTTSILAFYWSQKRWGNHPLAKTLAHHALPQSSWRAVASS INTEFRRIDKFATGAPSARVIVTDTWVMKVTTYRVDVAQQQDIHLTVTDSRQHELSPDSN TPVQFITIRVASVNPRVKPFDIRLNSTEYGELREKLHAPIRNAANVVIHQTLSDMFLETF KSLVEANQVYELSSNQELEPCIGCMQTNANIKLVKYCQEANEGECQQCYCRPMWCLTCMG KWFASRQDQQHPETWLSSHVPCPTCRAKFCIVDVCIVR
Uniprot No.

Target Background

Function

E3 ubiquitin-protein ligase involved in ER-associated protein degradation. It preferentially associates with the E2 enzyme UBE2J2.

Database Links

KEGG: xtr:548871

UniGene: Str.26819

Protein Families
TMEM129 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis TMEM129 and why is it significant for research?

TMEM129 in Xenopus tropicalis is a transmembrane protein that functions as an E3 ubiquitin-protein ligase. It is evolutionarily conserved and can be traced back to unicellular metazoan ancestors, with its unusual RING domain being preserved across species . The significance of this protein lies in its critical role in the endoplasmic reticulum-associated degradation (ERAD) pathway, which is responsible for protein quality control. TMEM129 forms an integral part of ER-resident dislocation complexes including Derlin-1, Derlin-2, VIMP, p97, SEL1L, and HRD1 . Studying this protein in X. tropicalis provides valuable insights into fundamental cellular processes of protein quality control and degradation mechanisms conserved across vertebrates.

How does the structure of Xenopus tropicalis TMEM129 compare to its human ortholog?

Xenopus tropicalis TMEM129 shares significant structural similarities with its human ortholog, particularly in the conserved C-terminal RING domain. Both contain an unusual C4C4-type RING domain rather than the classic RING-CH (C3HC4) or RING-H2 (C3H2C3) arrangements . This domain contains only cysteine residues for zinc coordination and features extended loops between zinc-coordinating cysteines .

The membrane topology is also conserved, with both proteins containing three transmembrane domains and adopting an N exo–C cyto orientation, positioning the C-terminal RING domain in the cytosol . This conserved topology is critical for its function, as it places the catalytic RING domain in the appropriate cellular compartment to interact with other components of the ubiquitination machinery. The high degree of conservation suggests that insights gained from studying the Xenopus protein can be meaningfully extrapolated to understand human TMEM129 function.

What are the basic characteristics of recombinant Xenopus tropicalis TMEM129 protein?

Recombinant Xenopus tropicalis TMEM129 protein has the following characteristics:

FeatureDescription
Gene Nametmem129
Other NamesE3 ubiquitin-protein ligase TM129, transmembrane protein 129
Protein SizeFull length mature protein (25-362 amino acids)
Expression SystemsE. Coli, Yeast, Baculovirus, Mammalian Cell, Cell-Free Expression
Purity≥85% as determined by SDS-PAGE
Available TagsHis-tagged versions available
Transmembrane DomainsThree transmembrane domains
TopologyN exo–C cyto orientation
Special FeaturesC4C4-type RING domain in C-terminus

The protein is non-glycosylated and contains a non-cleaved signal anchor sequence . Characterization by SDS-PAGE typically confirms that purified recombinant TMEM129 proteins have purity greater than or equal to 85% .

Why is Xenopus tropicalis preferred as a model organism for TMEM129 studies?

Xenopus tropicalis has emerged as a powerful model system for several compelling reasons:

  • Unlike Xenopus laevis, which is tetraploid, X. tropicalis has a compact diploid genome (~1.5×10^9 bp) with strong synteny to those of amniotes, simplifying orthology assignment and functional analysis .

  • The genome size is comparable to zebrafish, making it one of the smallest tetrapod genomes, which facilitates genetic studies .

  • X. tropicalis produces up to 9,000 embryos from a single mating, providing sufficient meiotic recombination events to map mutations or conduct various phenotypic analyses .

  • The early development closely resembles that of the well-understood X. laevis, allowing techniques and reagents to be readily transferred between the species .

  • Advanced genetic tools including high-throughput sequencing and solution-hybridization whole-exome enrichment technology enable powerful strategies for cloning novel mutations and reverse genetic identification of sequence lesions .

  • The wide range of functional and molecular assays available, combined with the ease of haploid genetics and gynogenesis, make X. tropicalis particularly suitable for genetic studies of evolutionarily conserved proteins like TMEM129 .

What techniques can validate the membrane topology of Xenopus tropicalis TMEM129?

Validating the membrane topology of Xenopus tropicalis TMEM129 requires multiple complementary approaches:

  • Glycosylation scanning mutagenesis: This technique involves introducing N-linked glycosylation sites at various positions throughout the protein sequence. Since glycosylation occurs only in the ER lumen, successful glycosylation of an engineered site indicates luminal localization. This approach has been successfully applied to determine that TMEM129 adopts an N exo–C cyto orientation with three transmembrane domains .

  • In vitro translation with microsomal membranes: Cell-free translation systems supplemented with canine pancreatic microsomal membranes can be used to assess membrane insertion and topology. Protease protection assays can then determine which regions are protected (luminal) versus exposed (cytosolic) .

  • Truncation scanning: Creating a series of truncated proteins and assessing their membrane insertion patterns provides information about transmembrane domain boundaries and orientation .

  • Fluorescence protease protection assay: By tagging different regions of TMEM129 with fluorescent proteins and monitoring fluorescence loss upon selective permeabilization and protease treatment, researchers can determine domain localization.

  • Cysteine accessibility methods: Engineering cysteine residues throughout the protein and assessing their accessibility to membrane-impermeant sulfhydryl reagents can map protein topology.

These experimental approaches are crucial because bioinformatic predictions of membrane protein topology are not always accurate, and understanding TMEM129's precise membrane arrangement is essential for elucidating its function in the ERAD pathway .

How can researchers experimentally validate the E3 ligase activity of TMEM129?

Experimental validation of TMEM129's E3 ligase activity can be accomplished through several methodologies:

  • In vitro ubiquitination assays: Purified recombinant TMEM129 can be incubated with E1 (UBA1), an appropriate E2 enzyme (such as UBE2D3 or UBE2J2), a substrate protein (such as S5a/Rpn10), ubiquitin, and ATP. Formation of poly-ubiquitinated substrate species, detectable by western blotting, confirms E3 ligase activity . A parallel reaction with RING-domain deleted TMEM129 serves as a negative control.

  • Auto-ubiquitination assays: In the absence of substrate protein, E3 ligases often demonstrate auto-ubiquitination activity. Incubation of TMEM129 with E1, E2, ubiquitin, and ATP, followed by western blotting for ubiquitin, can detect formation of polyubiquitin chains as evidence of catalytic activity .

  • Dominant-negative approaches: Expression of RING-less TMEM129 in cellular systems can result in a dominant-negative phenotype. For example, in US11-mediated HLA class I downregulation studies, expression of RING-less TMEM129 rescues HLA class I from degradation, confirming the importance of the RING domain for ligase activity .

  • E2 binding assays: The ability of TMEM129 to bind cognate E2 ubiquitin-conjugating enzymes can be assessed through co-immunoprecipitation or pull-down assays. This interaction is essential for E3 ligase function.

  • Zinc-binding assays: Since the RING domain coordinates zinc atoms, metal binding analyses can confirm proper folding of this catalytic domain.

These approaches collectively provide robust evidence of E3 ligase activity and can identify the specific E2 enzymes and substrates with which TMEM129 interacts .

What is the significance of TMEM129's unusual C4C4-type RING domain structure?

The C4C4-type RING domain of TMEM129 represents a rare and unusual E3 ligase structure with significant functional implications:

  • Unique zinc coordination: Unlike classic RING domains which contain a C3HC4 (RING-CH) or C3H2C3 (RING-H2) arrangement for coordinating two zinc atoms, TMEM129's RING domain uses eight cysteine residues exclusively for zinc coordination (C4C4) . This is extremely rare, with only a few other known examples in mammals, including cNOT4 .

  • Extended loops: TMEM129's RING domain contains unusually extended loops between its zinc-coordinating cysteines (AA289-308 and AA323-345), which may influence substrate recognition or interaction with other proteins .

  • Canonical E2 binding site: Despite its unusual structure, the RING domain retains a canonical E2 binding site, with an isoleucine residue between the first two cysteines, a tryptophan in position 4 of the second loop, and a proline between the final two cysteine residues . This explains its ability to function as an E3 ligase.

  • Evolutionary conservation: The unusual RING structure is conserved throughout holozoa, including unicellular organisms, suggesting its fundamental importance in protein quality control pathways throughout evolution .

  • Functional specificity: The unique structure may confer specificity for particular E2 enzymes or substrates. Research has shown that TMEM129 preferentially works with UBE2J2 in the context of US11-mediated HLA class I degradation .

This unusual RING domain makes TMEM129 an interesting subject for structural biology studies and may provide insights into novel mechanisms of E3 ligase function in the ERAD pathway.

How does TMEM129 integrate into the broader ERAD machinery in Xenopus tropicalis?

TMEM129 functions as an integral component of the endoplasmic reticulum-associated degradation (ERAD) machinery in Xenopus tropicalis through specific protein-protein interactions and a defined spatial arrangement:

  • Complex formation: TMEM129 associates with various ERAD components independent of viral proteins like US11, indicating its role in general ERAD processes. Co-immunoprecipitation experiments have demonstrated that TMEM129 interacts with Derlin-1, Derlin-2, VIMP, p97, SEL1L, and HRD1 . These interactions occur through both the transmembrane domains and the cytosolic regions of TMEM129.

  • Spatial organization: The tri-spanning membrane topology of TMEM129 positions its C-terminal RING domain in the cytosol, where it can access the ubiquitination machinery (E1 and E2 enzymes) and substrates as they emerge from the ER during retrotranslocation .

  • Functional cooperation with E2 enzymes: TMEM129 works specifically with the ER-associated E2 enzyme UBE2J2 to ubiquitinate substrates. This E2-E3 pairing is essential for ERAD function, as demonstrated in US11-mediated HLA class I degradation studies .

  • Retrotranslocation support: As part of the dislocation complex, TMEM129 likely facilitates the extraction of misfolded proteins from the ER membrane, working in conjunction with the AAA+ ATPase p97 and its cofactors .

  • Evolutionary conservation: The integration of TMEM129 into the ERAD machinery appears to be conserved throughout vertebrate evolution, suggesting that insights from Xenopus tropicalis studies may be applicable to understanding human ERAD mechanisms .

This comprehensive integration into the ERAD machinery positions TMEM129 as a key player in protein quality control, potentially affecting various developmental and physiological processes in Xenopus tropicalis that rely on proper protein homeostasis.

What are the optimal expression and purification methods for recombinant Xenopus tropicalis TMEM129?

Optimizing expression and purification of recombinant Xenopus tropicalis TMEM129 requires careful consideration of the protein's transmembrane nature and functional requirements:

Expression SystemAdvantagesConsiderationsPurification Approach
E. coliCost-effective, high yield, rapidMay need detergent solubilization, potential improper folding of transmembrane regionsIMAC with His-tag, followed by size exclusion chromatography
Cell-Free ExpressionBypasses toxicity issues, good for membrane proteinsRequires optimization of detergent/lipid mixturesAffinity purification in detergent micelles
Baculovirus/Insect CellsBetter folding of eukaryotic proteins, post-translational modificationsMore complex, time-consumingMembrane fraction isolation followed by affinity chromatography
Mammalian Cell ExpressionNative-like environment, proper folding likelyLower yields, expensiveGentle detergent extraction, affinity purification

Recommended protocol for E. coli expression:

  • Clone full-length tmem129 (coding for aa 25-362) into a vector with an N-terminal His-tag .

  • Transform into E. coli BL21(DE3) or Rosetta-gami strains.

  • Induce at low temperature (16-18°C) with reduced IPTG concentration (0.1-0.5 mM).

  • Extract membrane fraction using mild detergents (DDM, LMNG, or C12E8).

  • Purify using Ni-NTA affinity chromatography.

  • Apply size exclusion chromatography for final purity ≥85% .

For functional studies:
Cell-free expression systems may provide properly folded protein with greater functional activity. Recombinant TMEM129 expressed in this system can be directly incorporated into liposomes or nanodiscs for functional assays .

Quality control should include SDS-PAGE analysis, western blotting with anti-TMEM129 antibodies, and functional assessment through in vitro ubiquitination assays to verify E3 ligase activity .

What are appropriate experimental controls when studying TMEM129 function in Xenopus tropicalis?

When investigating TMEM129 function in Xenopus tropicalis, implementing appropriate controls is essential for robust and reproducible research:

Negative controls:

  • RING domain mutant: A TMEM129 construct with deleted RING domain (TMEM129ΔRING) or point mutations in zinc-coordinating cysteines serves as a catalytically inactive control. This has been shown to create a dominant-negative effect in US11-mediated HLA class I degradation .

  • TMEM129 knockdown/knockout: CRISPR/Cas-mediated knockout or shRNA-mediated knockdown of TMEM129 provides a genetic null background. Complementation with wild-type TMEM129 should rescue the phenotype .

  • Inactive E1/E2 enzymes: For in vitro ubiquitination assays, including reactions lacking ATP or using catalytically inactive E1 (UBA1) or E2 (UBE2J2) mutants can confirm the specificity of observed ubiquitination activity .

Positive controls:

  • Known ERAD substrates: Include well-characterized ERAD substrates such as misfolded glycoproteins when studying TMEM129's role in protein quality control.

  • Other E3 ligases: Compare TMEM129 activity with well-characterized ERAD E3 ligases such as HRD1/SYVN1 under identical conditions.

  • Cross-species rescue: Test whether human TMEM129 can rescue phenotypes in Xenopus tropicalis TMEM129-deficient embryos to assess functional conservation.

Specificity controls:

  • Binding partner verification: Confirm interactions with known ERAD components (Derlin-1, p97, etc.) through co-immunoprecipitation experiments with both wild-type and RING-deleted TMEM129 .

  • Subcellular localization: Verify ER localization of TMEM129 using co-localization with established ER markers like calnexin .

  • Membrane topology validation: Use glycosylation scanning mutagenesis to confirm the predicted N exo–C cyto orientation of TMEM129 .

Developmental controls:
For developmental studies in Xenopus tropicalis, include stage-matched wild-type embryos and careful documentation of developmental timing to account for natural variation in developmental progression .

Implementing these controls ensures that phenotypes can be specifically attributed to TMEM129 function and reduces the risk of misinterpreting experimental results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.