Recombinant Xenopus tropicalis Transmembrane protein 150A (tmem150a)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biological Systems

TMEM150A regulates critical cellular processes, including:

Phosphoinositide Metabolism

  • PI(4,5)P₂ Synthesis: TMEM150A associates with phosphatidylinositol 4-kinase (PI4KIIIα) in plasma membrane complexes, enhancing PI(4,5)P₂ production .

  • Autophagy Modulation: Linked to fasting-induced autophagy via PI(4,5)P₂-dependent pathways .

Immune Signaling

  • TLR4 Activation: Knockdown in HEK TLR4 cells increases CXCL8, IL6, and CCL5 secretion post-LPS stimulation, indicating a suppressive role in cytokine production .

  • Homeostasis: Basal cytokine levels rise in TMEM150A-deficient H292 lung epithelial cells, suggesting a role in immune regulation .

Cancer Prognosis

  • Glioblastoma Multiforme (GBM): Overexpression correlates with poor survival, stromal/immune infiltration, and RNA modifications (e.g., m6A, m5C) .

Experimental Models

  • TLR4 Signaling: TMEM150A knockdown in HEK TLR4 cells increases CXCL8 secretion by 2–3 fold at 100 ng/mL LPS, with parallel rises in CXCL8 transcripts .

  • GBM Studies: Overexpression in GBM cells correlates with Th17/Treg infiltration and RNA modification profiles, enabling biomarker discovery .

Key Findings

StudyMethodOutcomeImplication
TLR4 Activation siRNA knockdown + LPS↑ Cytokine (CXCL8, IL6, CCL5) secretion and transcripts in HEK/H292 cellsTMEM150A suppresses TLR4-mediated cytokine responses
GBM Prognosis TCGA RNA-seq + TIMER↑ TMEM150A correlates with stromal/immune scores and poor survivalPotential therapeutic target in GBM
Autophagy Fasting models↑ TMEM150A expression induces autophagy via PI(4,5)P₂ signalingLinks metabolic stress to autophagic pathways

Mechanistic Insights

  • PI4KIIIα Complex: TMEM150A stabilizes PI4KIIIα in liquid-disordered membrane domains, promoting PI(4,5)P₂ synthesis .

  • Cytokine Regulation: Acts upstream of NF-κB/IRAK pathways, modulating cytokine transcription .

  • RNA Modifications: Overexpression in GBM associates with m6A and m5C modifications, suggesting epigenetic roles .

Future Directions

  • Therapeutic Targeting: Inhibiting TMEM150A may reduce GBM progression or modulate immune responses in inflammatory diseases .

  • Structural Studies: Resolving TMEM150A’s interaction with PI4KIIIα could guide drug design.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard final glycerol concentration is 50% and can serve as a reference point.
Shelf Life
Shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
tmem150a; tmem150; TEgg093b02.1; TNeu137l02.1; Transmembrane protein 150A; Transmembrane protein 150
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
27-271
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem150a
Target Protein Sequence
VMNHHVCPVENWTYNLTCTDDNTKAGTPKSCCTLEDVPLISKCGTYPPESCLFSLIGNVG AFMVVIICLLRYSQVIEVSQRSWLNTTALIAGCTNAAGLVMVGNFQVDYAKSLHYIGAGV AFPAGLLFVCLSSILSYQIAASALDYWLGHLRVSLTIVALISLVLSGVFFIQESFLMQHL AAICEWIFVLDILVFYGTFAYEFGSVSTDTMMAALQSSSARSCKSPGSSSTSTHLHCNAE RIAMI
Uniprot No.

Target Background

Function
This protein regulates the localization of phosphatidylinositol 4-kinase (PI4K) to the plasma membrane.
Database Links

KEGG: xtr:549648

UniGene: Str.31231

Protein Families
DRAM/TMEM150 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Xenopus tropicalis TMEM150A and why is it used in research?

Transmembrane protein 150A (TMEM150A) from Xenopus tropicalis is a membrane-spanning protein with significant research value in developmental biology and comparative genomics. Xenopus tropicalis serves as an ideal experimental amphibian model due to its diploid genome (unlike the tetraploid X. laevis), shorter generation time, and comprehensive whole-genome sequence data availability. These characteristics make this organism particularly suitable for genetic studies, multigenerational experiments, and transgenic approaches that can provide insights into conserved vertebrate developmental mechanisms . The recombinant form of TMEM150A is utilized to study protein function, structure, and expression patterns across developmental stages in X. tropicalis, which can provide insights applicable to understanding conserved protein functions across vertebrate species.

How does Xenopus tropicalis TMEM150A compare to its orthologs in other species?

The transmembrane protein 150A is evolutionarily conserved across vertebrate species, though with varying degrees of sequence homology. When comparing X. tropicalis TMEM150A with its human ortholog, significant structural conservation exists, particularly in the transmembrane domains. This conservation makes X. tropicalis an excellent model for studying fundamental aspects of TMEM150A function that may translate to human biology.

Research has shown that TMEM150A may have clinical relevance in humans, as studies have demonstrated its overexpression in glioblastoma multiforme (GBM) and association with poor prognosis . When conducting cross-species research with TMEM150A, it's methodologically important to:

  • Perform thorough sequence alignments to identify conserved functional domains

  • Validate antibody cross-reactivity before attempting interspecies comparisons

  • Consider the evolutionary distance when interpreting functional conservation data

What are the optimal conditions for handling recombinant Xenopus tropicalis TMEM150A protein?

For optimal preservation of structural integrity and bioactivity of recombinant X. tropicalis TMEM150A, adhere to these methodological guidelines:

Storage Conditions:

  • Primary storage: -20°C in Tris-based buffer with 50% glycerol

  • Extended storage: -80°C

  • Working aliquots: Store at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

Handling Protocol:

  • Thaw frozen aliquots rapidly at room temperature

  • Upon complete thawing, immediately transfer to ice

  • For experimental use, dilute in appropriate buffer immediately before application

  • For Western blotting or immunoassays, maintain denaturing conditions if targeting internal epitopes

Stability Considerations:
When designing experiments requiring extended protein exposure to experimental conditions, conduct preliminary stability tests at your specific working temperature, pH, and buffer composition to establish the viable working window for your assays.

What techniques are most effective for studying TMEM150A expression patterns in Xenopus tropicalis?

Multiple complementary techniques can be employed to comprehensively characterize TMEM150A expression patterns:

For mRNA Expression Analysis:

  • RT-qPCR: Most quantitative approach for stage-specific or tissue-specific expression levels

  • In situ hybridization: Provides spatial localization within tissues

  • RNA-Seq: Offers comprehensive transcriptomic context for expression analysis

For Protein Expression Analysis:

  • Western blotting: Quantifies protein levels and confirms antibody specificity

  • Immunohistochemistry/Immunofluorescence: Reveals cellular and subcellular localization

  • Flow cytometry: Useful for quantifying expression in dissociated cells

Methodological Considerations:
When designing expression studies, exploit X. tropicalis' advantages as a model system by incorporating developmental timeline analysis. Unlike mammalian models, X. tropicalis permits easy access to all developmental stages and straightforward manipulation of embryos through microsurgery, mRNA injection for overexpression, or morpholino antisense oligonucleotides for knockdown studies .

How can researchers effectively utilize CRISPR/Cas9 to generate TMEM150A knockouts in Xenopus tropicalis?

CRISPR/Cas9-mediated gene editing in X. tropicalis requires specialized approaches due to the amphibian embryonic system:

Protocol Overview:

  • Design sgRNAs targeting conserved exons of TMEM150A (avoid regions with potential off-target effects)

  • Inject Cas9 protein with sgRNA into one-cell stage embryos

  • Confirm editing efficiency by sequencing PCR products from F0 mosaic embryos

  • Raise F0 frogs to sexual maturity and screen for germline transmission

  • Establish homozygous lines through selective breeding

Critical Considerations:

  • Injection timing is crucial: perform at one-cell stage for maximum distribution

  • Optimize Cas9:sgRNA ratios to minimize toxicity while maintaining editing efficiency

  • Validate knockout at both DNA (sequencing) and protein levels (Western blot)

  • Plan for phenotypic assessment across multiple developmental stages

The diploid genome of X. tropicalis significantly simplifies knockout generation compared to the allotetraploid X. laevis, making it particularly advantageous for genetic manipulation studies . Complete knockout lines can typically be established within 6-8 months, allowing for relatively rapid generation of stable genetic models.

What methodologies best characterize the membrane topology and trafficking of TMEM150A in Xenopus tropicalis cells?

Understanding TMEM150A's membrane topology and trafficking requires multi-faceted experimental approaches:

For Topology Mapping:

  • Protease protection assays: Determine which domains are accessible from each side of the membrane

  • Fluorescent protein fusion constructs: Tag specific domains with GFP/RFP to visualize cellular orientation

  • Glycosylation mapping: Introduce artificial N-glycosylation sites to identify extracellular domains

For Trafficking Analysis:

  • Live-cell imaging with fluorescently tagged TMEM150A

  • Pulse-chase analysis with metabolic labeling

  • Colocalization studies with compartment-specific markers

  • Brefeldin A sensitivity assays to assess Golgi-dependent trafficking

Experimental Design Table:

MethodologyPrimary Information GainedTechnical RequirementsLimitations
Protease ProtectionDomain orientation relative to membranePurified membranes, selective proteasesCannot distinguish among internal membranes
Live ImagingReal-time trafficking dynamicsConfocal microscopy, fluorescent fusion constructsPotential artifact from fusion tags
Glycosylation MappingExtracellular domain identificationGlycosylation site prediction tools, glycosidase assaysRequires mutation of native sequence
ColocalizationSubcellular compartment associationCompartment-specific markers, high-resolution microscopyCorrelation not necessarily causation

When implementing these approaches, X. tropicalis offers the advantage of being amenable to both in vitro cell culture systems and in vivo imaging in transparent embryos, providing complementary datasets on protein behavior in different contexts.

How can researchers effectively identify interaction partners of TMEM150A in Xenopus tropicalis?

Identifying protein interaction partners is crucial for understanding TMEM150A function. Several complementary approaches can be employed:

Co-Immunoprecipitation (Co-IP) Based Methods:

  • Standard Co-IP with TMEM150A-specific antibodies

  • Tandem affinity purification using tagged TMEM150A

  • Proximity-dependent biotin identification (BioID) to capture transient interactions

Mass Spectrometry-Based Approaches:

  • Cross-linking mass spectrometry (XL-MS) to capture direct interactions

  • Stable isotope labeling by amino acids in cell culture (SILAC) for quantitative interaction profiling

  • Label-free quantitative proteomics to identify enriched proteins

Validation Methodologies:

  • Bimolecular fluorescence complementation (BiFC) for visualizing interactions in live cells

  • Förster resonance energy transfer (FRET) to confirm direct physical interaction

  • Mammalian two-hybrid assays for interaction domain mapping

  • Co-localization studies using confocal microscopy

When applying these techniques to X. tropicalis systems, researchers should consider tissue-specific expression patterns and developmental timing, as interaction partners may vary across developmental stages and tissue contexts. X. tropicalis offers the advantage of easy manipulation through microinjection of tagged constructs into embryos , allowing for both in vitro and in vivo interaction studies.

What evidence suggests potential roles for TMEM150A in disease pathology based on Xenopus tropicalis studies?

While direct evidence from X. tropicalis studies is limited in the provided search results, parallel research on TMEM150A in human systems provides important insights that can guide X. tropicalis research directions:

Cancer Biology Connections:
Research has revealed that TMEM150A overexpression is significantly associated with poor prognosis in human glioblastoma multiforme (GBM) . This finding suggests potential oncogenic functions that merit investigation in X. tropicalis models. The ROC analysis demonstrated that TMEM150A overexpression serves as an effective diagnostic biomarker for GBM with an area under the curve of 0.95 .

Methodological Approach for X. tropicalis Disease Models:

  • Generate transgenic X. tropicalis lines with controlled TMEM150A expression

  • Implement tissue-specific overexpression using promoter-driven constructs

  • Create xenograft models using human cancer cells in immunocompromised X. tropicalis

  • Validate findings through comparative analysis of signaling pathways

How does TMEM150A function differ between Xenopus tropicalis and mammalian systems?

Comparative analysis between X. tropicalis and mammalian TMEM150A reveals both similarities and differences that can inform experimental design:

Expression Pattern Differences:
Temporal and spatial expression patterns may vary between species. While comprehensive expression data for X. tropicalis TMEM150A is not detailed in the provided search results, researchers should conduct comparative expression analyses across developmental stages and tissue types.

Methodological Approach for Comparative Studies:

  • Perform rescue experiments using cross-species constructs

  • Generate chimeric proteins to identify functionally conserved domains

  • Conduct parallel knockdown/knockout studies in multiple model systems

  • Implement cross-species transcriptomic analysis following perturbation

Advantage of X. tropicalis for Comparative Studies:
The diploid genome of X. tropicalis provides a cleaner genetic background for functional studies compared to the tetraploid X. laevis . Additionally, the availability of whole-genome sequence data facilitates more accurate orthology mapping and comparative genomic analysis.

How can researchers utilize X. tropicalis TMEM150A in studying RNA modification mechanisms?

Recent findings indicate potential connections between TMEM150A and RNA modifications that can be explored in X. tropicalis:

RNA Modification Types Associated with TMEM150A:
The RM2TARGET database identifies TMEM150A as a target gene associated with various RNA modifications, including m6A, m1A, m5C, and m7G modifications . These modifications can significantly impact RNA stability, localization, and translation efficiency.

Methodological Approaches:

  • Methylated RNA immunoprecipitation sequencing (MeRIP-seq) to identify modification sites

  • CRISPR-mediated manipulation of RNA modification enzymes to assess impacts on TMEM150A expression

  • RNA stability assays comparing wild-type and modification-deficient TMEM150A transcripts

  • Ribosome profiling to assess translational impacts of RNA modifications

Experimental Design Considerations:
When investigating RNA modifications in X. tropicalis, capitalize on the developmental accessibility of this model system by analyzing modification patterns across key developmental transitions. This temporal analysis can reveal regulatory mechanisms that might be conserved in higher vertebrates.

What advanced imaging techniques best visualize TMEM150A dynamics in living Xenopus tropicalis embryos?

X. tropicalis embryos offer exceptional opportunities for advanced imaging due to their external development and relative transparency:

Cutting-Edge Imaging Approaches:

  • Light sheet fluorescence microscopy (LSFM) for whole-embryo visualization with minimal phototoxicity

  • Super-resolution techniques (STED, PALM, STORM) for nanoscale localization

  • Fluorescence recovery after photobleaching (FRAP) to measure protein mobility

  • Förster resonance energy transfer (FRET) for protein-protein interaction dynamics

Methodological Workflow:

  • Generate fluorescent protein fusions with TMEM150A that preserve protein function

  • Microinject mRNA encoding fusion proteins at specific blastomeres to target lineages

  • Implement mosaic analysis to compare labeled and unlabeled cells within the same embryo

  • Apply tissue clearing techniques for deep tissue imaging when necessary

Developmental Imaging Timeline:
X. tropicalis embryos develop according to the Nieuwkoop and Faber staging system, similar to X. laevis . When designing longitudinal imaging experiments, carefully select developmental windows relevant to the biological process under investigation, and adjust imaging parameters to accommodate growth and increasing tissue density.

What are the common challenges in working with recombinant Xenopus tropicalis TMEM150A and how can they be addressed?

Researchers frequently encounter specific challenges when working with transmembrane proteins like TMEM150A:

Challenge: Protein Solubility and Aggregation

  • Solution: Optimize buffer conditions with appropriate detergents (CHAPS, DDM, or Triton X-100)

  • Implementation: Test multiple detergent types and concentrations in parallel

  • Validation: Assess protein monodispersity using dynamic light scattering

Challenge: Antibody Specificity

  • Solution: Validate antibodies using both positive controls (overexpression systems) and negative controls (CRISPR knockout lines)

  • Implementation: Perform epitope mapping to ensure recognition of conserved regions

  • Validation: Confirm specificity across multiple detection methods (Western blot, immunoprecipitation, immunohistochemistry)

Challenge: Expression Variability in Transgenic Lines

  • Solution: Implement site-specific integration techniques for consistent expression

  • Implementation: Use I-SceI meganuclease method which works effectively in X. tropicalis

  • Validation: Characterize multiple independent transgenic lines to account for position effects

Troubleshooting Decision Tree:
For systematic problem resolution, implement a structured approach based on the nature of the technical issue:

  • Is the issue related to protein detection? → Validate antibody specificity and optimize detection conditions

  • Is the issue related to protein function? → Verify protein folding and post-translational modifications

  • Is the issue related to localization? → Confirm tag positioning does not interfere with trafficking signals

How can researchers reconcile contradictory data when studying TMEM150A function in different experimental contexts?

When faced with apparently contradictory results about TMEM150A function, implement these methodological approaches:

Systematic Analysis Framework:

  • Catalog all variables between experimental systems (species differences, cell types, developmental stages)

  • Identify assay-specific limitations that might explain discrepancies

  • Design controlled experiments that systematically vary only one parameter at a time

  • Implement orthogonal methods to validate key findings

Reconciliation Strategies:

  • Conduct parallel experiments in both systems simultaneously

  • Develop chimeric constructs to pinpoint domains responsible for functional differences

  • Perform cross-species rescue experiments to test functional conservation

  • Analyze regulatory networks in both systems to identify contextual differences

Data Integration Approach:
When contradictory data persists, consider that TMEM150A may have context-dependent functions. Build a comprehensive model that accounts for:

  • Tissue-specific interaction partners

  • Developmental stage-specific roles

  • Species-specific regulatory mechanisms

  • Experimental system artifacts

By systematically addressing these variables, researchers can develop more nuanced understanding of protein function that accommodates apparently contradictory observations.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.