Recombinant Xenopus tropicalis Transmembrane protein 150B (tmem150b)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization of Recombinant TMEM150B

Recombinant TMEM150B is produced using expression systems such as E. coli, yeast, or mammalian cells to generate partial or full-length protein variants . Key features include:

Functional Features

  • Autophagy Regulation: Modulates autophagosome accumulation under basal conditions and enhances autophagic flux .

  • BMP Signaling Antagonism: Physically interacts with ALK2 to inhibit bone morphogenetic protein (BMP) signaling in Xenopus embryogenesis .

Research Applications and Experimental Use

Recombinant TMEM150B is employed in diverse experimental contexts:

Table 1: Key Applications of Recombinant TMEM150B

ApplicationExperimental ModelKey Findings
Embryonic PatterningXenopus laevisTMEM150B knockdown causes head defects and shortened body axis .
Autophagy RegulationHuman cell linesOverexpression enhances survival under glucose deprivation .
Protein Interaction StudiesXenopus tropicalis embryosBinds ALK2 to regulate BMP signaling during axis formation .

Available Recombinant Products

Commercial and academic sources provide TMEM150B reagents with varying specifications:

Table 2: Recombinant TMEM150B Variants

Product NameHost SystemPurityApplicationsSource
Recombinant X. tropicalis TMEM150B (partial)E. coli/Yeast≥85%ELISA, SDS-PAGE, WBMyBioSource
Recombinant X. laevis TMEM150B-BCell-free system≥85%Functional assaysMyBioSource

In Embryogenesis

  • TMEM150B is expressed in the Spemann organizer of Xenopus embryos and is induced by Activin/Nodal signaling .

  • Knockdown disrupts dorsoventral patterning, highlighting its role in BMP pathway regulation .

In Autophagy and Cell Survival

  • TMEM150B overexpression increases autophagosome formation but does not alter apoptosis rates in cancer cells .

  • Promotes clonogenic survival under glucose deprivation independently of macroautophagy .

Contrasting Roles Across Species

  • In mice, Tmem150b knockout does not affect oocyte maturation or spindle organization .

  • Human TMEM150B interacts with BRSK1 kinase and MCM8 helicase, suggesting roles in DNA repair .

Challenges and Future Directions

  • Structural Limitations: Full-length structural data for X. tropicalis TMEM150B remains unavailable, necessitating homology modeling .

  • Functional Redundancy: Compensatory mechanisms may explain minimal phenotypes in KO models (e.g., mouse oocytes) .

  • Therapeutic Potential: Its role in autophagy and cell survival warrants exploration in disease models like cancer .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless otherwise specified. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem150b; Modulator of macroautophagy TMEM150B; Transmembrane protein 150B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
19-230
Protein Length
Full Length of Mature Protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem150b
Target Protein Sequence
IWIVYGMSVSNGSVNLTDGFPFISLCGTYPPQSCVFGQVLNVGAMLGVWISVIRFQQIRD YGCHSVLNSVSLAMGLLCALGTSIVGNFQQSNQLETHLAGAFLAFVIGNIYFWMQTVLTY MVKPKHGGCYIGPIRFCLSVACTALIVLMAVFLKLNMKSISAICEWIVAMILFLLYGLFS VDFWHLDGHYFHVKKRTAIPNEVEVSTVTLNI
Uniprot No.

Target Background

Function
This protein is a modulator of macroautophagy, leading to the accumulation of autophagosomes under basal conditions and enhancing autophagic flux. It represses cell death and promotes long-term clonogenic survival of cells cultivated in the absence of glucose in a macroautophagy-independent manner. It may play a role in extracellular matrix engulfment or growth factor receptor recycling, both of which can influence cell survival.
Database Links

KEGG: xtr:548751

UniGene: Str.27389

Protein Families
DRAM/TMEM150 family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein.

Q&A

What is TMEM150B and what is its basic structure?

TMEM150B (Transmembrane protein 150B), also known as Transmembrane protein 224, is a transmembrane protein found in various species including Xenopus tropicalis. The protein contains multiple transmembrane domains with the amino acid sequence including regions such as "IWIVYGMSVSNGSV..." as identified in recombinant proteins. It belongs to the DRAM (damage-regulated autophagy modulator) family, which includes five members: DRAM-1, DRAM-2, and TMEM150A/B/C . The protein's structural features enable it to span cellular membranes, which is critical for its biological functions.

How evolutionary conserved is TMEM150B across species?

TMEM150B appears to be conserved across various vertebrate species, indicating potential evolutionary importance. The protein has been identified and studied in both mammals (mice) and amphibians (Xenopus tropicalis), sharing functional domains and structural similarities . This conservation suggests that TMEM150B may have fundamental cellular functions that have been maintained throughout vertebrate evolution. Comparative studies between species can provide insights into both conserved functions and species-specific adaptations of this protein.

What are the optimal conditions for storing and handling recombinant TMEM150B?

For optimal storage and handling of recombinant Xenopus tropicalis TMEM150B, researchers should store the protein at -20°C for regular use and at -80°C for extended storage. The protein is typically provided in a Tris-based buffer with 50% glycerol, optimized for stability . Working aliquots can be stored at 4°C for up to one week, but repeated freezing and thawing should be avoided as this may compromise protein integrity and activity . When working with the protein, it's advisable to thaw aliquots on ice and maintain cold chain management to preserve functionality.

How can researchers generate TMEM150B knockout models?

TMEM150B knockout models can be generated using CRISPR/Cas9 technology. A successful approach documented in research involved deleting a 989 bp fragment encompassing exons 2-4 of the gene . Validation of the knockout can be performed through multiple methods:

  • Genotyping via PCR from genomic DNA (e.g., from mouse tails)

  • RT-PCR using cDNA obtained by reverse transcription of mRNA from relevant tissues

  • Confirmation of deletion by Sanger sequencing

Specific primers for genotyping can be designed flanking the deletion region. For example, in a mouse model study, researchers used the following primer sequences for wild type allele: F: 5′-GACTGCTTGGAGATCCAGCT-3′, R: 5′-GTGGAGGCAGTCTGACTATC-3′; and for delete allele: dF: 5′-CTTTGTGCCCTGGGTACCTC-3′, R: 5′-GTGGAGGCAGTCTGACTATC-3′ .

What expression analysis techniques are most effective for TMEM150B research?

For effective expression analysis of TMEM150B, quantitative reverse-transcription PCR (qRT-PCR) has proven to be a reliable method. Researchers have successfully used this technique to quantify TMEM150B expression across various tissues and developmental stages . The protocol involves:

  • Total RNA extraction using standard methods (e.g., Qiagen RNase mini kit)

  • cDNA synthesis via reverse transcription

  • Real-time PCR using SYBR Green Master Mix with specific primers

Example primer sequences for mouse Tmem150b include: F: 5′-TTGCTGCCTGTCATCTTATTTC-3′, R: 5′-AGGTTTTGACGCCCCAGT-3′ . These should be used with an appropriate housekeeping gene control such as GAPDH. Additionally, immunofluorescence staining can be employed to visualize protein localization in cells and tissues, providing complementary data to expression studies.

What is the role of TMEM150B in autophagy regulation?

TMEM150B functions as a modulator of macroautophagy, causing accumulation of autophagosomes under basal conditions and enhancing autophagic flux . As a member of the DRAM family (specifically DRAM-3), TMEM150B appears to be involved in regulating cellular degradation and recycling pathways. This role in autophagy connects to its broader function in cellular homeostasis and stress response. The protein represses cell death and promotes long-term clonogenic survival of cells , suggesting it may help cells adapt to stressful conditions by facilitating efficient autophagy.

Does TMEM150B play a role in reproductive biology?

Despite initial associations with age at natural menopause, early menopause, and premature ovarian insufficiency (POI), experimental evidence suggests TMEM150B may not be essential for female reproduction in mice. Studies using TMEM150B knockout mice showed no significant differences in:

  • Oocyte meiotic maturation (first polar body emission rates were similar between knockout and wild type mice)

  • Spindle morphology in MII stage oocytes

  • Follicle development and corpus luteum formation

  • Estrous cycling

  • Fertility metrics and hormonal profiles

These findings are summarized in the following data from fertility tests:

GenotypesTotal pupsLitters/MousePups/LitterTime to first litter (days)
+/+ (n=5)1774.0 ± 0.458.85 ± 1.5395 ± 3.98
−/− (n=5)1894.2 ± 0.378.59 ± 0.8298 ± 6.18

How does TMEM150B interact with other cellular proteins and pathways?

While specific protein interaction partners for TMEM150B have not been extensively documented in the provided search results, its role in autophagy regulation suggests potential interactions with key autophagy machinery proteins. As a transmembrane protein, TMEM150B likely interacts with membrane components and possibly signaling molecules that regulate autophagosome formation and maturation . Given its classification as DRAM-3 (DRAM-related/associated member 3), it may share functional relationships with other DRAM family proteins (DRAM-1, DRAM-2, TMEM150A, and TMEM150C) . Future research employing techniques such as co-immunoprecipitation, proximity labeling, or yeast two-hybrid screening would be valuable to identify specific interaction partners.

How might functional redundancy with other DRAM family members affect TMEM150B knockout phenotypes?

An important consideration in TMEM150B research is the potential for functional redundancy with other DRAM family members. As noted by researchers, "TMEM150B, also named as DRAM-related/associated member 3 (DRAM-3), is one of the five members of the DRAM family which includes DRAM-1, DRAM-2 and TMEM150A/B/C" and "functional redundancy cannot be excluded" . This redundancy might explain the absence of phenotypes in TMEM150B knockout mice. Future research should consider:

  • Generating and characterizing double or triple knockout models targeting multiple DRAM family members

  • Conducting comparative expression analyses of all family members in tissues of interest

  • Performing rescue experiments with different family members to test functional equivalence

  • Using stress conditions to potentially unmask phenotypes that might be compensated under normal conditions

These approaches would help determine whether TMEM150B functions are truly dispensable or whether they are compensated by other family members.

What are the molecular mechanisms by which TMEM150B modulates autophagy?

While TMEM150B is known to modulate macroautophagy, causing accumulation of autophagosomes under basal conditions and enhancing autophagic flux , the precise molecular mechanisms remain to be fully elucidated. Advanced research could investigate:

  • The specific step(s) of the autophagy pathway affected by TMEM150B (initiation, elongation, fusion, or degradation)

  • Direct protein-protein interactions with core autophagy machinery components

  • Potential involvement in signaling pathways that regulate autophagy (mTOR, AMPK, etc.)

  • Structural determinants within TMEM150B responsible for its autophagy-modulating functions

  • Transcriptional or post-translational regulation of TMEM150B under various cellular conditions

Understanding these mechanisms would provide insights into both basic autophagy regulation and potential therapeutic applications targeting this pathway.

What are the key considerations for researchers planning TMEM150B studies?

Researchers planning studies on TMEM150B should consider several important factors based on current knowledge:

  • Potential functional redundancy with other DRAM family members that might mask phenotypes in single gene knockout models

  • The importance of studying the protein under both basal and stress conditions to reveal context-dependent functions

  • Tissue-specific expression patterns, with particular attention to oocytes where expression is high

  • The dual roles in autophagy modulation and cell survival promotion

  • The need for appropriate model systems that recapitulate relevant aspects of human biology, especially when investigating disease associations

Additionally, researchers should be aware that despite associations with reproductive timing in humans, experimental evidence does not support an essential role for TMEM150B in female fertility in mice . This discrepancy warrants careful interpretation and potentially the use of additional model systems.

What technological advances could accelerate TMEM150B research?

Several technological advances could significantly accelerate research on TMEM150B functions and mechanisms:

  • CRISPR-based screening approaches to identify genetic interactions and redundancies with other DRAM family members

  • Advanced imaging techniques like super-resolution microscopy to visualize TMEM150B localization and dynamics in cellular membranes

  • Structural biology approaches to determine the three-dimensional structure of TMEM150B and inform structure-function relationships

  • Single-cell transcriptomics and proteomics to characterize cell type-specific expression patterns and responses

  • Patient-derived organoids or iPSC models to study TMEM150B functions in human-relevant systems, particularly for disease associations

These technological approaches would help address current knowledge gaps and potentially reveal novel functions and mechanisms of this transmembrane protein.

How might synthetic biology approaches enhance studies of TMEM150B?

Synthetic biology approaches offer innovative ways to study TMEM150B function:

  • Engineered protein variants with domain swaps between DRAM family members to identify functional domains

  • Optogenetic or chemogenetic control of TMEM150B activity to enable temporal precision in functional studies

  • Synthetic gene circuits to study TMEM150B in controlled cellular environments

  • Biosensors to monitor TMEM150B-dependent autophagy dynamics in real-time

  • Engineered cellular systems with minimal genomes to study TMEM150B function with reduced genetic complexity

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.