Recombinant Xenopus tropicalis Transmembrane protein 17A (tmem17-a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary based on the purchasing method or location. Please consult your local distributors for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. The shelf life for the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a particular tag type in mind, please inform us, and we will prioritize its development.
Synonyms
tmem17-a; Transmembrane protein 17A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem17-a
Target Protein Sequence
MAQAAGVRRQLDSLTRNIFLRDVGRTVPEKSGAPLTGDSEVAPSVSLQIFLYFNAFYFPF WWVCYVIMLQLKYVLLPDYYKFILVVLLILMSVIEVIRLYLGYSGNLQEKVPELAGFCLL SILLQLPLLLFLLCDPGLEPLPLERAVHGILTAFLLIQIPISIFALRKATRHLAGRFHLL GDLDGRA
Uniprot No.

Target Background

Function
Transmembrane component of the tectonic-like complex, a complex localized at the transition zone of primary cilia. This complex acts as a barrier, preventing the diffusion of transmembrane proteins between the cilia and plasma membranes. It is essential for ciliogenesis and sonic hedgehog (SHH) signaling.
Database Links

KEGG: xtr:548354

UniGene: Str.37512

Protein Families
TMEM17 family
Subcellular Location
Cell projection, cilium membrane; Multi-pass membrane protein.

Q&A

What is the optimal reconstitution procedure for lyophilized tmem17-a protein?

For optimal reconstitution of lyophilized tmem17-a protein:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% is commonly recommended)

  • Aliquot the reconstituted protein for long-term storage at -20°C/-80°C

This procedure helps maintain protein stability and prevents degradation from repeated freeze-thaw cycles. Working aliquots can be stored at 4°C for up to one week .

What expression systems are commonly used for producing recombinant tmem17-a?

The most documented expression system for recombinant Xenopus tropicalis tmem17-a is E. coli . This bacterial expression system is preferred for producing the full-length protein with fusion tags for several reasons:

  • Cost-effectiveness and scalability for research applications

  • Established protocols for induction and purification

  • Compatibility with N-terminal tagging approaches (typically His-tag)

  • Ability to achieve greater than 90% purity as determined by SDS-PAGE

For functional studies requiring post-translational modifications, researchers may need to consider eukaryotic expression systems, though these are less documented in the literature for tmem17-a specifically.

How can researchers effectively validate the functional activity of recombinant tmem17-a in experimental systems?

Validating functional activity of recombinant tmem17-a requires multiple complementary approaches:

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm proper protein folding

    • Size-exclusion chromatography to verify oligomeric state

  • Functional binding assays:

    • Pull-down assays with known binding partners

    • Surface plasmon resonance (SPR) to measure binding kinetics

  • Cellular localization validation:

    • Transfection of tagged constructs in appropriate cell lines

    • Immunofluorescence microscopy to confirm proper membrane localization

  • Activity assays:

    • Based on tmem17's role in the PI3K/AKT pathway, phosphorylation status of downstream targets can be measured

    • Cell proliferation assays comparing wild-type vs. protein-treated conditions

For ciliary proteins like TMEM17, localization to the transition zone can be confirmed using co-localization studies with established ciliary markers in ciliated cell models.

What are the optimal experimental conditions for studying tmem17-a interactions with the PI3K/AKT pathway?

To study tmem17-a interactions with the PI3K/AKT pathway, researchers should consider:

  • Cell model selection:

    • GBM cell lines show high TMEM17 expression and PI3K/AKT pathway activity (LN229 and U87MG are documented models)

    • Xenopus model systems for evolutionary conservation studies

  • Experimental approach:

    • RNA interference (siRNA or shRNA) targeting TMEM17

    • Western blot analysis focusing on phosphorylated PI3K (p-PI3K) and phosphorylated AKT (p-AKT)

    • Rescue experiments using PI3K activators such as 740Y-P

  • Functional readouts:

    • Cell proliferation assays (CCK-8, EdU incorporation)

    • Apoptosis measurement by flow cytometry

    • Migration/invasion assays (Transwell)

Recent research has shown that knockdown of TMEM17 substantially decreases protein expression of p-PI3K and p-AKT, and this growth inhibitory effect can be partially reversed by treatment with the PI3K activator 740Y-P .

What approaches can be used to study the role of tmem17-a in ciliary transition zone formation?

Studying tmem17-a in ciliary transition zone formation requires specialized techniques:

  • Genetic manipulation approaches:

    • CRISPR/Cas9-mediated gene editing to create knockout models

    • Complementation studies with wildtype and mutant constructs

  • Protein localization studies:

    • Super-resolution microscopy for precise spatial mapping within the transition zone

    • Co-immunoprecipitation (Co-IP) with known transition zone components

  • Functional assessment:

    • Ciliary membrane composition analysis using selective markers

    • Protein diffusion barrier testing using fluorescent reporter proteins

  • Hierarchical assembly analysis:

    • Systematic knockdown of transition zone proteins to establish dependency relationships

    • Comparative analysis of N/C-terminus truncation constructs to identify functional domains

Researchers should note that TMEM17 appears to function within the MKS module of proteins in the ciliary transition zone, with specific interactions with TMEM-107, TMEM-231, JBTS-14, and MKS-1, suggesting a hierarchical assembly model .

How does TMEM17 contribute to signaling pathways involved in cancer progression?

TMEM17 contributes to cancer progression through multiple mechanisms:

  • PI3K/AKT pathway modulation:

    • TMEM17 activation promotes phosphorylation of PI3K and AKT

    • This activation cascade enhances cell proliferation and inhibits apoptosis

    • Knockdown studies confirm TMEM17 regulates GBM cell growth through this pathway

  • Transcriptional regulation:

    • Transcription factor YY1 has been identified as an upstream regulator of TMEM17 expression

    • This creates a potential feedback loop that can amplify oncogenic signaling

  • Correlation with patient outcomes:

    • Multivariate Cox proportional hazard regression analysis indicates GBM patients with high TMEM17 expression have decreased survival

    • TMEM17 has been identified as an independent risk factor associated with poor prognosis

  • Cancer-specific expression pattern:

    • TMEM17 exhibits relatively high expression in several cancers, including SKCM (skin cutaneous melanoma), small cell lung cancer, and GBM (glioblastoma multiforme)

Experimental validation shows knockdown of TMEM17 significantly reduces proliferation, increases apoptosis, and inhibits migratory function of GBM cells, supporting its role as an oncogenic driver .

What methodological approaches are most effective for studying the evolutionary conservation of TMEM17 function across species?

To effectively study evolutionary conservation of TMEM17 function across species:

  • Comparative genomic analysis:

    • Sequence alignment of TMEM17 orthologs across diverse species

    • Phylogenetic tree construction to map evolutionary relationships

    • Identification of conserved domains and motifs

  • Cross-species functional complementation:

    • Rescue experiments in model organisms using orthologs from different species

    • Patient mutation mimicking studies to test functional conservation

  • Structural biology approaches:

    • Comparative modeling of transmembrane domains

    • Investigation of conserved protein-protein interaction interfaces

  • Functional conservation testing:

    • Comparative assessment of subcellular localization across species

    • Analysis of interacting protein networks in different model systems

Research indicates that despite evolutionary distance, important functional domains of TMEM17 may be conserved, as evidenced by studies showing that human TMEM107 mutations affecting function also affect the function of nematode TMEM-107 orthologs .

What is the relationship between TMEM17 and other transition zone proteins in ciliopathy-related disorders?

The relationship between TMEM17 and other transition zone proteins is characterized by:

  • Hierarchical organization:

    • TMEM17 functions within the MKS module of the transition zone

    • In nematode models, TMEM-17 occupies a peripheral level (Layer 3) in the hierarchy

    • TMEM-107 recruits a submodule including TMEM-17, TMEM-231, JBTS-14, and MKS-1

  • Synthetic genetic interactions:

    • In C. elegans, mutations in MKS module genes (potentially including tmem-17) synthetically interact with NPHP module genes

    • These interactions suggest functional redundancy between different transition zone modules

  • Clinical manifestations:

    • Mutations in transition zone proteins including TMEM17-related proteins are associated with ciliopathies

    • Joubert syndrome has been specifically linked to mutations in the related protein TMEM107

  • Functional consequences:

    • Disruption of transition zone proteins can lead to membrane diffusion barrier defects

    • This results in abnormal ciliary composition and signaling abnormalities

Research indicates that the transmembrane domains or interhelical linkers of TMEM107, rather than its short cytosolic N- and C-termini, are critical for recruiting TMEM17 and other proteins to the transition zone .

What are the common challenges in working with recombinant transmembrane proteins like tmem17-a and how can they be overcome?

Common challenges and solutions when working with recombinant tmem17-a include:

ChallengeSolutionRationale
Protein aggregationAdd 6% trehalose to storage bufferTrehalose stabilizes protein conformation and prevents aggregation
Low solubilityMaintain Tris/PBS-based buffer at pH 8.0Optimal pH prevents precipitation and maintains solubility
Degradation during storageAdd 50% glycerol and store at -80°C in small aliquotsPrevents freeze-thaw damage and proteolytic degradation
Loss of activity over timeAvoid repeated freeze-thaw cycles; store working aliquots at 4°CMaintains functional integrity for experimental use
Poor reconstitutionCentrifuge vial before opening; reconstitute to 0.1-1.0 mg/mLEnsures complete recovery of lyophilized protein

Additionally, researchers should consider detergent selection for membrane protein studies, with mild non-ionic detergents often being optimal for maintaining native conformation while providing sufficient solubilization.

How can researchers accurately assess the purity and activity of commercial recombinant tmem17-a preparations?

To accurately assess purity and activity of commercial tmem17-a:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (should exceed 90% purity)

    • Western blot with anti-His tag or specific anti-TMEM17 antibodies

    • Mass spectrometry for definitive identification and purity analysis

  • Activity assessment:

    • Binding assays with known interaction partners

    • Secondary structure analysis via circular dichroism

    • Thermal shift assays to evaluate protein stability

  • Functional validation:

    • Cell-based reporter assays measuring PI3K/AKT pathway activation

    • In vitro reconstitution of protein complexes with known partners

    • Membrane incorporation efficiency in artificial lipid bilayers

Researchers should also verify the protein's structural integrity by confirming the expected molecular weight (accounting for the His-tag) and comparing the experimental data with the manufacturer's certificate of analysis.

What novel experimental approaches are being developed to study the role of TMEM17 in ciliopathies and cancer?

Emerging experimental approaches for studying TMEM17 include:

  • Advanced imaging techniques:

    • Cryo-electron microscopy (Cryo-EM) for structural analysis of TMEM17 in membrane complexes

    • Super-resolution microscopy for precise localization within the ciliary transition zone

    • Live-cell imaging with tagged constructs to track dynamic protein interactions

  • Single-cell approaches:

    • Single-cell RNA sequencing to identify cell-type-specific expression patterns

    • Single-cell proteomics to map protein-protein interaction networks

  • Organoid models:

    • Patient-derived organoids to study TMEM17 function in disease-relevant contexts

    • Brain organoids for investigating TMEM17's role in GBM progression

  • High-throughput screening:

    • CRISPR screens to identify synthetic lethal interactions with TMEM17

    • Small molecule screens to identify inhibitors of TMEM17-mediated signaling

Recent research has established a foundation for these approaches by demonstrating TMEM17's role in the PI3K/AKT pathway in GBM and its recruitment to the ciliary transition zone by TMEM107 .

How might understanding the transcriptional regulation of TMEM17 lead to new therapeutic approaches?

Understanding TMEM17 transcriptional regulation offers several therapeutic opportunities:

  • Targeting transcription factor binding:

    • Research has identified YY1 as promoting TMEM17 transcription

    • Small molecule inhibitors of YY1-DNA binding could reduce TMEM17 expression

    • CRISPR-based epigenetic editing could modify regulatory regions of the TMEM17 gene

  • Pathway-specific interventions:

    • TMEM17's role in activating the PI3K/AKT pathway suggests combination approaches

    • Dual targeting of TMEM17 expression and PI3K/AKT signaling could enhance efficacy

    • PI3K inhibitors might be particularly effective in TMEM17-overexpressing tumors

  • Biomarker development:

    • TMEM17 expression levels could serve as prognostic markers in GBM

    • Multivariate analysis shows high TMEM17 expression correlates with decreased survival

    • Patient stratification based on TMEM17 status could guide personalized treatment approaches

  • RNA-based therapeutics:

    • siRNA or antisense oligonucleotides targeting TMEM17 mRNA

    • In vitro studies show TMEM17 knockdown reduces cancer cell proliferation and increases apoptosis

These approaches leverage the finding that TMEM17 functions as an independent risk factor in GBM, supporting its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.