Recombinant Xenopus tropicalis Transmembrane protein 184C (tmem184c)

Shipped with Ice Packs
In Stock

Description

Expression and Purification

The protein is produced via codon-optimized E. coli expression systems, followed by affinity chromatography using His-tag purification . Post-purification, it is lyophilized for stability and reconstituted in sterile water (0.1–1.0 mg/mL) with glycerol (5–50%) for long-term storage at -80°C .

Biological Roles

  • Synaptic Regulation: Orthologs like Drosophila Tmep regulate synaptic calcium levels and neuromuscular junction architecture, suggesting TMEM184C’s role in synaptic excitability .

  • Locomotion: Knockdown studies in Drosophila highlight Tmep’s necessity for larval locomotion and adult viability, with sexual dimorphism observed in behavioral deficits .

  • Membrane Trafficking: Localization to endosomal compartments and synaptic vesicles implies involvement in intracellular transport .

Functional Associations

From Harmonizome :

CategoryAssociations
Tissue ExpressionBrain, intestine, limb, testis
Molecular PathwaysPredicted miRNA targets
Disease LinksEpilepsy, neuromuscular disorders

Research Applications

  • SDS-PAGE Analysis: Used to validate protein purity and molecular weight .

  • ELISA Development: Recombinant TMEM184C serves as an antigen for antibody production .

  • Synaptic Physiology: Functional studies in model organisms (e.g., Drosophila) to explore synaptic hyperexcitability mechanisms .

Comparative Analysis Across Species

TMEM184C orthologs exhibit high structural conservation, enabling cross-species functional studies:

SpeciesUniProt IDLength (aa)Key Features
X. tropicalisQ28CV2443Full-length, E. coli-expressed
HumanQ9NVA4437Tumor suppressor candidate
BovineQ17QL943890% sequence identity to X. tropicalis
RatQ810F5503Extended C-terminal domain

Future Directions

  • Mechanistic Studies: Elucidate TMEM184C’s role in calcium signaling and synaptic vesicle trafficking .

  • Therapeutic Potential: Explore links to epilepsy and neuromuscular disorders using vertebrate models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will then fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery time information, please consult your local distributors.
Note: All protein shipments are standardly equipped with blue ice packs. If dry ice shipment is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
tmem184c; tmem34; Transmembrane protein 184C; Transmembrane protein 34
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-443
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem184c
Target Protein Sequence
MPCTCGNWRRWIRPLVVLLYIVGLIVGVPICIWKLQKMEVGVHTKAWFIAGIFVLMTIPI SLWGILQHLVHYTQPELQKPIIRILWMVPIYSVDSWIALKYPDIAIYVDTCRECYEAYVI YNFMIFLLNYLTNRCPNLALVLEAKDQQRHLPPLCCCPPWAMGDVLLFRCKLGVLQYTVV RPVTTVIALICQLTGVYGEGDFSVKNAWTYLVIINNVSQVFAMYCLVLFYKVLKEELNPI QPVGKFLCVKMVVFVSFWQAVFIAILVKAGVISNTWEWKKVQDVATGLQDFIICVEMFLA AVAHHFSFTYKPYVQEAEEGSCFDSFLAMWDISDIRADISEQVRNVGRTVLGRPRKMFFN DDLEQNEHTSLLSSSTQDPISAASSIPPSPSGHYQGFGQTITPQTTPTATTMPEELYSAD SPEADLVADHSKVPDESCNHLDS
Uniprot No.

Target Background

Function
This protein may play a role in cell growth.
Database Links

KEGG: xtr:549286

UniGene: Str.14637

Protein Families
TMEM184 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and reconstitution conditions for recombinant Xenopus tropicalis TMEM184C protein?

Recombinant Xenopus tropicalis TMEM184C protein requires specific handling protocols to maintain its structural integrity and functionality. The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . For long-term storage, aliquoting is necessary to avoid repeated freeze-thaw cycles which can compromise protein integrity.

For reconstitution, researchers should follow this methodology:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being most commonly used)

  • Aliquot for long-term storage at -20°C/-80°C

The reconstituted protein is typically stored in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain stability . When working with the protein, it is recommended to keep working aliquots at 4°C for up to one week rather than subjecting the sample to repeated freeze-thaw cycles.

What experimental applications are suitable for recombinant Xenopus tropicalis TMEM184C protein?

Recombinant Xenopus tropicalis TMEM184C protein can be utilized in multiple experimental applications for studying protein function and interactions. Primary applications include:

  • SDS-PAGE Analysis: The purified protein (>90% purity) is suitable for size verification and quantitative analysis through SDS-PAGE .

  • Structural Studies: The full-length protein can be used for structural characterization through techniques such as circular dichroism spectroscopy and X-ray crystallography.

  • Protein-Protein Interaction Studies: His-tagged TMEM184C can be employed in pull-down assays to identify binding partners and interaction networks.

  • Antibody Production: The recombinant protein serves as an excellent antigen for generating specific antibodies for immunological studies.

  • Functional Assays: When introduced into appropriate cellular contexts, the recombinant protein can be used to study membrane trafficking and cellular signaling.

These applications enable researchers to investigate the molecular mechanisms underlying TMEM184C function in developmental processes, particularly those relevant to neural development and ciliary function, which are areas where transmembrane proteins play critical roles .

How does TMEM184C expression compare across different tissues and developmental stages?

TMEM184C exhibits distinctive expression patterns across various tissues, reflecting its biological roles in different cellular contexts. According to RNA-seq data from the GTEx Portal, TMEM184C shows variability in expression across different tissue types .

In Xenopus development specifically, expression analysis reveals that TMEM184C has temporally regulated expression patterns during key developmental stages. This temporal regulation suggests roles in specific developmental processes, potentially including neural development and morphogenesis.

The spatial expression pattern of TMEM184C in Xenopus can be visualized using techniques such as RNA in situ hybridization, similar to methods used for related genes like pibf1 . These approaches reveal tissue-specific localization patterns that correspond to the protein's functional domains.

When designing experiments to study TMEM184C expression, researchers should consider:

  • Developmental stage-specific analysis

  • Tissue-specific expression profiling

  • Comparison with orthologous expression in other model organisms

  • Correlation with known developmental pathways

Understanding these expression patterns provides insight into the potential functions of TMEM184C in normal development and disease states.

What are the key differences between TMEM184C and related family members like TMEM184B?

While TMEM184C and TMEM184B belong to the same protein family, they exhibit distinct structural features and functional roles that are important for researchers to recognize:

FeatureTMEM184CTMEM184B
Structure7-pass transmembrane proteinEndosomal 7-pass transmembrane protein
FunctionLess characterizedRoles in synaptic structure and axon degeneration
Disease AssociationNot well documentedAssociated with neurodevelopmental disorders
Mutation EffectsUnknownDe novo variants cause intellectual disability, corpus callosum hypoplasia, seizures, microcephaly
Cellular LocalizationMembrane-associatedEndosomal

TMEM184B has been more extensively characterized and has established roles in neural development. Pathogenic variants in TMEM184B are associated with neurodevelopmental disorders, intellectual disability, corpus callosum hypoplasia, seizures, and microcephaly . The protein contains a pore domain where disease-associated variants often cluster.

TMEM184B variants can alter TFEB nuclear localization, a master regulator of lysosomal biogenesis, suggesting a role in nutrient signaling pathways . This function in cellular metabolic pathways may be shared with TMEM184C, though direct evidence is currently limited.

The distinct functions of these related proteins highlight the importance of specific experimental approaches when studying each family member to avoid conflating their respective roles.

How can Xenopus models be effectively utilized to study TMEM184C function in development?

Xenopus provides an excellent vertebrate model system for studying TMEM184C function due to its experimental tractability and developmental similarities to mammals. Researchers can employ several methodologies to investigate TMEM184C in Xenopus:

  • Microinjection Techniques: Similar to studies with other genes, researchers can inject mRNA encoding wild-type or mutant forms of TMEM184C into specific blastomeres at the 4-cell stage to target particular tissues like the epidermal cell lineage. For example, 0.4 pmol of mRNA per embryo can be used, with fluorescein dextran (50 ng) as a lineage tracer .

  • Morpholino-Mediated Knockdown: Translation-blocking morpholino oligomers can be designed to target TMEM184C, typically injected at 4 pmol per embryo. This approach allows for tissue-specific knockdown when combined with targeted injections .

  • CRISPR/Cas9 Genome Editing: For generating stable mutant lines, CRISPR/Cas9 can be employed to create specific mutations in the TMEM184C gene, following Xenopus transgenic nomenclature guidelines .

  • Phenotypic Analysis: Following genetic manipulation, embryos can be cultured until appropriate developmental stages (e.g., stage 30) and analyzed for morphological defects, particularly in structures where TMEM184C is expressed.

  • Immunofluorescence Staining: Protein localization can be assessed using specific antibodies, following fixation protocols appropriate for the target tissue (e.g., 4% paraformaldehyde for in situ hybridization or Dent's fixative for protein staining) .

These approaches allow researchers to investigate the developmental consequences of TMEM184C disruption, potentially revealing roles in processes such as neural development, ciliary function, or tissue morphogenesis.

What methodologies are recommended for analyzing variant effects of TMEM184C in Xenopus models?

To study the functional consequences of TMEM184C variants, researchers can implement a comprehensive experimental framework similar to approaches used for related proteins like TMEM184B:

  • Variant mRNA Injection: Wild-type and variant TMEM184C mRNAs can be transcribed in vitro using kits like mMessage mMachine SP6 Transcription kit. For testing dominant effects, 200 pg of each TMEM184C mRNA can be injected alone. For dose-dependent effects, titration experiments can be performed with variable doses (50 pg, 100 pg, 150 pg) while maintaining a total mRNA concentration of 200 pg .

  • In vivo Complementation Studies: To test loss-of-function effects, 200 pg mRNA can be co-injected with 3 ng morpholino targeted against endogenous TMEM184C .

  • Structural Modeling: Computational approaches can predict how variants affect protein stability, similar to analyses performed for TMEM184B. This includes modeling of transmembrane domains and pore regions to understand potential functional consequences of mutations .

  • Cellular Localization Studies: Immunofluorescence or fusion protein approaches can determine if variants alter the subcellular localization of TMEM184C.

  • Transcriptional Impact Analysis: RNA-seq can be employed to determine if TMEM184C variants alter downstream gene expression patterns.

  • Protein-Protein Interaction Analysis: Co-immunoprecipitation and proximity labeling approaches can reveal if variants disrupt normal protein interactions.

These methodologies provide a comprehensive framework for understanding how TMEM184C variants might contribute to developmental abnormalities or disease states, drawing parallels from what has been learned about TMEM184B-associated pathologies .

How might TMEM184C function in ciliary processes based on experimental evidence from Xenopus models?

While direct evidence for TMEM184C in ciliary processes is limited, insights can be drawn from studies of related proteins and transmembrane proteins in Xenopus ciliated tissues. Xenopus larval skin contains multiciliated cells (MCCs) that function similarly to human airway epithelia in mucociliary clearance, making them an excellent model for studying ciliary proteins .

The methodological approach to study potential ciliary functions of TMEM184C would include:

  • Morpholino Knockdown: Translation blocking morpholinos can be designed and injected into the skin lineage at the 4-cell stage to deplete TMEM184C specifically in tissues with ciliated cells.

  • Validation of Knockdown Efficiency: Immunofluorescence staining can confirm protein depletion in targeted cells.

  • Analysis of Ciliary Structure: Staining of ciliary axonemes with antibodies against acetylated tubulin (Tuba4a) can reveal if TMEM184C depletion affects cilia number or morphology.

  • Functional Ciliary Assays: High-speed video microscopy of larval skin can assess if TMEM184C disruption affects coordinated ciliary beating, which can be quantified using kymographs from high-speed movies.

  • Rescue Experiments: Co-injection of wild-type TMEM184C mRNA with morpholinos can determine if observed phenotypes are specific to TMEM184C loss.

Based on studies of other transmembrane proteins in Xenopus, TMEM184C might function in cilia formation, maintenance, or coordinated beating. If TMEM184C plays a role similar to other ciliary proteins, its depletion could result in reduced cilia numbers or impaired ciliary function, with potential implications for human ciliopathies .

What considerations are important when designing transgenic Xenopus lines to study TMEM184C?

Creating transgenic Xenopus lines for TMEM184C research requires careful consideration of several technical and biological factors:

  • Nomenclature Compliance: Following established Xenopus transgenic nomenclature guidelines is essential for consistent reporting. For example, a transgenic X. laevis line expressing X. tropicalis TMEM184C would be named according to conventions like: Xla.Tg(Xtr.TMEM184C:reporter) .

  • Promoter Selection: Choose appropriate promoters based on experimental goals:

    • For ubiquitous expression: CMV or EF1α promoters

    • For tissue-specific expression: tissue-specific promoters (e.g., neural-specific promoters if studying TMEM184C in neural development)

    • For studying the endogenous expression pattern: include the native TMEM184C promoter region

  • Reporter Systems: Consider fusion proteins or bicistronic constructs:

    • Direct fusion of fluorescent proteins (GFP, mCherry) to TMEM184C for localization studies

    • Bicistronic expression using 2A peptides or IRES elements to co-express TMEM184C and reporters without direct fusion

    • Inclusion of epitope tags (His, FLAG, HA) for biochemical studies

  • Integration Methods:

    • I-SceI meganuclease-mediated transgenesis for random integration

    • CRISPR/Cas9-mediated targeted integration for site-specific insertion

    • Transgenic efficiency can be enhanced by optimizing DNA concentration and quality

  • Screening Strategies:

    • Use of visible markers like fluorescent lens crystallin (e.g., γ-crystallin:GFP) for easy identification of transgenic animals

    • Molecular verification through PCR and sequencing to confirm transgene integration

  • Control Lines:

    • Generate appropriate control lines expressing only the reporter under the same regulatory elements

    • Create rescue lines expressing wild-type TMEM184C for complementation studies with mutant variants

These considerations ensure the development of transgenic Xenopus resources that can effectively address questions about TMEM184C function in development and disease.

How can RNA-seq approaches be optimized for studying TMEM184C expression and function in Xenopus?

RNA-seq provides powerful insights into TMEM184C expression patterns and transcriptional networks. Researchers can optimize RNA-seq approaches for TMEM184C studies in Xenopus with the following methodological considerations:

  • Sample Preparation Protocol:

    • Use the Illumina TruSeq protocol to create unstranded polyA+ libraries

    • Sequence on platforms like Illumina HiSeq to produce 76-bp paired-end reads

    • Target a coverage of 50M reads (with a median of ~82M total reads typically achieved)

  • Tissue and Developmental Stage Selection:

    • Collect samples from multiple developmental stages to capture dynamic expression changes

    • Include tissues where TMEM184C is potentially functionally relevant (e.g., neural tissues, ciliated epithelia)

    • Compare wild-type, knockdown, and overexpression conditions to identify TMEM184C-dependent transcriptional changes

  • Bioinformatic Analysis Pipeline:

    • Filter data for unique mapping, proper pairing, and exon overlap

    • Use tools like RNA-SeQC for gene expression level quantification in TPM (Transcripts Per Million)

    • Compute median expression levels per gene/per tissue type for comparative analysis

  • Differential Expression Analysis:

    • Compare expression profiles between control and TMEM184C-manipulated samples

    • Identify gene networks and pathways affected by TMEM184C perturbation

    • Validate key findings through qRT-PCR and in situ hybridization

  • Integration with Other Data Types:

    • Correlate RNA-seq data with protein localization studies

    • Integrate with ChIP-seq data to identify transcription factors regulating TMEM184C

    • Compare findings across species to identify conserved TMEM184C functions

This comprehensive RNA-seq approach will yield insights into TMEM184C's transcriptional regulation and its downstream effects on gene expression networks in Xenopus, potentially revealing functional roles in development and disease.

What are the challenges and solutions in producing functional recombinant Xenopus tropicalis TMEM184C protein for structural studies?

Producing functional recombinant transmembrane proteins like TMEM184C presents unique challenges that require specialized approaches:

  • Expression System Selection:

    • Challenge: E. coli systems (as used for the commercial TMEM184C ) may not provide proper folding and post-translational modifications for transmembrane proteins

    • Solution: Consider eukaryotic expression systems like insect cells (Sf9, High Five) or mammalian cells (HEK293, CHO) for improved folding and modification

  • Solubilization and Purification:

    • Challenge: Transmembrane proteins require detergents for extraction from membranes, which can affect protein stability

    • Solution: Screen multiple detergents (DDM, LMNG, GDN) or use styrene-maleic acid copolymer lipid particles (SMALPs) to maintain native lipid environment

  • Protein Yield and Purity:

    • Challenge: Transmembrane proteins often express at lower levels than soluble proteins

    • Solution: Optimize codon usage for expression system, use strong inducible promoters, and develop multi-step purification protocols to achieve >95% purity

  • Maintaining Native Conformation:

    • Challenge: Detergent-solubilized proteins may not maintain native conformation

    • Solution: Validate protein folding using circular dichroism spectroscopy and functional assays

  • Crystallization for Structural Studies:

    • Challenge: Transmembrane proteins are difficult to crystallize due to their hydrophobic surfaces

    • Solution: Consider lipidic cubic phase crystallization methods or cryo-EM for structural determination

  • Functional Validation:

    • Challenge: Confirming that recombinant protein retains native function

    • Solution: Develop functional assays based on predicted activities (e.g., if TMEM184C has transporter activity, measure substrate transport in reconstituted proteoliposomes)

Implementing these strategies will improve the likelihood of obtaining functional recombinant Xenopus tropicalis TMEM184C protein suitable for structural and functional studies, advancing our understanding of this important transmembrane protein.

How can researchers integrate TMEM184C studies in Xenopus with human disease research?

Integrating TMEM184C research in Xenopus with human disease studies requires strategic approaches that leverage the strengths of this model organism while establishing clinical relevance:

  • Variant Functional Analysis:

    • Similar to TMEM184B studies , identify human TMEM184C variants from clinical databases (ClinVar, DECIPHER)

    • Test these variants in Xenopus through mRNA injection and assess developmental consequences

    • Use in vivo complementation assays to determine if variants cause loss- or gain-of-function effects

  • Disease Modeling:

    • Generate Xenopus models with TMEM184C variants that mimic human mutations

    • Characterize phenotypes at cellular, tissue, and organismal levels

    • Focus on evolutionarily conserved processes likely to be relevant to human pathology

  • Molecular Pathway Analysis:

    • Identify molecular pathways affected by TMEM184C disruption in Xenopus

    • Determine if these pathways are similarly affected in human patient samples or cell lines

    • Use Xenopus models to test potential therapeutic interventions targeting these pathways

  • Ciliopathy Research Connection:

    • Given the established use of Xenopus in ciliopathy research , investigate if TMEM184C functions in ciliary processes

    • If confirmed, screen for TMEM184C variants in human ciliopathy cohorts

    • Use Xenopus to model specific ciliopathy-associated TMEM184C variants

  • Translational Research Strategy:

    • Develop medium-throughput screens in Xenopus embryos to identify compounds that rescue TMEM184C-associated phenotypes

    • Test promising compounds in mammalian models and eventually human cell lines

    • Establish biomarkers in Xenopus that can be translated to clinical diagnostic applications

This integrated approach establishes a translational pipeline from basic Xenopus studies to human disease relevance, maximizing the impact of TMEM184C research on understanding and potentially treating human diseases.

What are the emerging research frontiers for TMEM184C in developmental biology?

As research on TMEM184C continues to evolve, several promising directions are emerging that integrate diverse experimental approaches and biological questions:

  • Systems Biology Integration: Comprehensive analysis of TMEM184C within developmental gene regulatory networks, combining transcriptomics, proteomics, and functional studies to place this protein in the broader context of developmental signaling pathways.

  • Evolutionary Developmental Biology: Comparative analysis of TMEM184C function across diverse vertebrate species, from fish to mammals, to understand both conserved functions and species-specific adaptations.

  • Single-Cell Resolution Studies: Application of single-cell RNA-seq and spatial transcriptomics to understand cell-type specific roles of TMEM184C during development, particularly in tissues with complex cellular heterogeneity.

  • Mechanistic Dissection of Protein Domains: Structure-function analysis of individual TMEM184C domains to determine their specific contributions to protein function, potentially revealing novel therapeutic targets.

  • Integration with Human Genomics: Systematic analysis of human genetic variants in TMEM184C and correlation with developmental disorders, establishing Xenopus as a validation platform for variant pathogenicity.

These research frontiers represent opportunities for significant discoveries about TMEM184C function in development and disease, highlighting the continuing importance of basic research on this transmembrane protein across model systems, particularly in Xenopus tropicalis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.