Recombinant Xenopus tropicalis Transmembrane protein 18 (tmem18)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. To request a specific tag, please specify it in your order; we will prioritize fulfilling this request.
Synonyms
tmem18; TEgg098f11.1; Transmembrane protein 18
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-136
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem18
Target Protein Sequence
MAEDPGLWTLLERAPIDWKEPWLIGLAVFHILCLIVTYVSFKSYPLQICHFLLMVVLVSC AEYINEFAAMHWRSYSKQQYFDSSGMFISLAFSAPLLCNTIIIVVHWVYKTLCVMTELKT LQQKRKESREKRKKKE
Uniprot No.

Target Background

Database Links
Protein Families
TMEM18 family
Subcellular Location
Nucleus membrane; Multi-pass membrane protein.

Q&A

What is TMEM18 and why is it studied in Xenopus tropicalis?

TMEM18 (Transmembrane protein 18) is a highly conserved gene located on chromosome 2 in humans that encodes a transmembrane protein involved in weight regulation through both central and peripheral mechanisms. The protein is highly expressed in the central nervous system, particularly in brain regions such as the hypothalamus, which regulates eating behavior . TMEM18 has been identified through multiple genome-wide association studies (GWAS) as significantly associated with obesity and BMI .

Xenopus tropicalis serves as an excellent model organism for studying TMEM18 for several reasons. First, X. tropicalis has a diploid genome, unlike the allotetraploid genome of Xenopus laevis, making it more suitable for genetic analyses . Second, X. tropicalis has a shorter generation time compared to X. laevis, facilitating multigenerational experiments . Finally, X. tropicalis demonstrates remarkable synteny with mammalian genomes, often in stretches of a hundred genes or more, which is far greater than that seen between fish and mammals . This genomic conservation makes findings in X. tropicalis potentially more translatable to human health research.

How can recombinant X. tropicalis TMEM18 be expressed and purified for experimental use?

Recombinant Xenopus tropicalis TMEM18 can be expressed using several expression systems, with the most common approach involving cloning the full-length cDNA into appropriate expression vectors. The process typically follows these methodological steps:

First, the full-length cDNA of X. tropicalis TMEM18 can be amplified by RT-PCR using primers designed based on the genome sequence database (e.g., from Ensembl) . The amplified cDNA can then be cloned into entry vectors like pENTR/D-Topo and subsequently subcloned into expression vectors appropriate for the intended expression system . For mammalian expression, vectors such as pVenus-NLS can be used, while for Xenopus oocyte expression, vectors like pOX(+) are suitable .

For protein production and purification, recombinant TMEM18 is typically expressed with affinity tags (though the specific tag type might be determined during the production process) . The protein is optimally stored in a Tris-based buffer with 50% glycerol at -20°C, or at -80°C for extended storage . To maintain protein integrity, it's recommended to avoid repeated freezing and thawing cycles, and working aliquots should be stored at 4°C for up to one week .

For functional studies, the recombinant protein can be expressed in heterologous expression systems such as HeLa cells or Xenopus oocytes, which have been successfully used for other X. tropicalis membrane proteins like TRPV1 . When working with membrane proteins like TMEM18, optimization of detergent conditions during purification is critical to maintain the protein's native conformation and functionality.

Why is Xenopus tropicalis preferred over Xenopus laevis for genetic studies of TMEM18?

Xenopus tropicalis offers several distinct advantages over Xenopus laevis for genetic studies of TMEM18, making it the preferred model system for such investigations. The primary advantage stems from X. tropicalis having a diploid genome, in contrast to the allotetraploid genome of X. laevis . This genomic simplicity makes conventional genetic analyses more straightforward and interpretable, as researchers don't have to contend with multiple gene copies that could complicate genetic manipulations and phenotypic analyses.

Additionally, X. tropicalis requires a significantly shorter time to reach sexual maturity compared to X. laevis, facilitating multigenerational experiments that are essential for genetic studies . This shorter generation time enables researchers to more rapidly establish transgenic lines and generate mutant lines, which are crucial for investigating gene function through loss-of-function approaches .

Another significant advantage is that the X. tropicalis genome displays remarkable synteny with mammalian genomes, often maintaining gene order across stretches of a hundred genes or more . This conservation of genome organization exceeds that observed between fish and mammals, making findings in X. tropicalis potentially more relevant to human health and development. The availability of a high-quality genome sequence for X. tropicalis, which was completed before that of X. laevis, provides an additional resource for researchers interested in studying TMEM18 and its genomic context .

What experimental approaches can be used to investigate TMEM18 function in Xenopus tropicalis?

Investigation of TMEM18 function in Xenopus tropicalis can be approached through multiple complementary methodologies. For genetic manipulation, researchers can employ techniques such as CRISPR/Cas9-mediated gene editing to generate knockout or knockin mutants. This approach has been facilitated by the development of genetic mapping resources for X. tropicalis, including a reliable genetic map based on simple sequence length polymorphisms (SSLPs) . Additionally, gynogenetic screening can expedite the mapping of genetic lesions, as the frequency of recessive mutations in gynogenetically-derived embryo populations correlates with their distance from the centromere .

For functional characterization, heterologous expression systems offer valuable insights. TMEM18 can be expressed in cell lines such as HeLa cells using transfection reagents like Lipofectamine, with expression confirmed via fluorescent protein tags . Alternatively, the Xenopus oocyte expression system allows for electrophysiological characterization using two-electrode voltage-clamp methods, as has been demonstrated with other X. tropicalis membrane proteins .

Tissue-specific expression and localization studies can be conducted using immunohistochemistry with specific antibodies against TMEM18. This approach has been successfully applied to other proteins in X. tropicalis, particularly in neuronal tissues . For dynamic expression studies, quantitative PCR can measure TMEM18 mRNA levels in different physiological states, such as after food deprivation or in dietary intervention studies .

Transgenic approaches offer another powerful methodology. Viral vectors, such as recombinant vesicular stomatitis virus (rVSV), have been effectively used to deliver transgenes into the Xenopus nervous system with high efficiency . This approach could be adapted to overexpress TMEM18 or introduce tagged versions for localization studies.

How does Xenopus tropicalis TMEM18 compare structurally and functionally with its orthologues in other species?

Xenopus tropicalis TMEM18 exhibits remarkable evolutionary conservation across diverse species, reflecting its fundamental biological importance. At the amino acid level, X. tropicalis TMEM18 shows approximately 92% sequence identity with X. laevis, 61% with rattlesnake, 64% with chicken, and 60-64% with mammalian orthologues . This high degree of conservation extends to species that diverged from the human lineage over 1500 million years ago, making TMEM18 one of the most conserved human obesity-related genes identified to date .

Structurally, TMEM18 proteins across species share common features, including multiple transmembrane domains that anchor the protein within cellular membranes. The conservation of these structural elements suggests functional constraints that have maintained the protein's architecture throughout evolution. The X. tropicalis TMEM18 protein consists of 136 amino acids, which is comparable to its orthologues in other species .

Functionally, TMEM18 appears to play conserved roles in weight regulation and energy homeostasis across species. In humans and other mammals, TMEM18 is involved in central and peripheral weight regulation mechanisms, including energy balance, central appetite control, and adipogenesis . Genome-wide association studies have consistently identified TMEM18 locus polymorphisms as risk factors for obesity across different populations .

Comparative studies between species have revealed both similarities and differences in TMEM18 function. For instance, while the gene is expressed in the hypothalamus across species, its regulation in response to feeding status may vary. In mouse models, hypothalamic and brainstem TMEM18 mRNA levels did not show significant changes in several feeding-related experimental paradigms, including food deprivation, consumption of palatable foods, and diet-induced weight gain . This suggests potential species-specific aspects of TMEM18 regulation that warrant further investigation in X. tropicalis.

What methodological approaches can be used to study the role of TMEM18 in obesity using the Xenopus tropicalis model?

Investigating TMEM18's role in obesity using Xenopus tropicalis requires sophisticated methodological approaches that leverage the unique advantages of this model organism. A comprehensive research strategy might include the following components:

Genetic manipulation techniques can be employed to alter TMEM18 expression or function. CRISPR/Cas9 gene editing can generate knockout or knockin X. tropicalis lines with specific TMEM18 modifications . Additionally, transgenic approaches using viral vectors like rVSV can deliver modified TMEM18 variants to specific tissues . The effects of these genetic manipulations on metabolic parameters, feeding behavior, and body composition can then be assessed.

For nutritional intervention studies, protocols similar to those used in mouse models can be adapted for X. tropicalis. These might include controlled feeding experiments with varying caloric densities or macronutrient compositions . For example, researchers could expose X. tropicalis to diets supplemented with sucrose or lipids (similar to the 10% sucrose or 4.1% Intralipid used in mouse studies) and monitor changes in body weight, feeding behavior, and TMEM18 expression patterns .

Expression analysis using quantitative PCR can determine how TMEM18 mRNA levels respond to various physiological conditions, such as fasting, refeeding, or exposure to different diets . Tissue-specific expression patterns can be mapped using in situ hybridization or immunohistochemistry, with particular attention to hypothalamic and adipose tissue expression.

For functional characterization at the cellular level, primary cell cultures derived from X. tropicalis tissues can be established. For instance, adipocyte cultures could be used to investigate TMEM18's role in adipogenesis, while hypothalamic neuronal cultures might reveal its function in central appetite regulation .

To establish genotype-phenotype correlations, researchers can perform SNP genotyping of the TMEM18 locus in X. tropicalis populations with varying metabolic phenotypes. Statistical approaches similar to those used in human studies can then be applied to identify associations between specific TMEM18 variants and obesity-related traits .

How can protein-protein interaction studies be designed to identify binding partners of X. tropicalis TMEM18?

Identifying protein interaction partners of Xenopus tropicalis TMEM18 requires methodical approaches that accommodate the challenges of working with membrane proteins. A comprehensive strategy would incorporate multiple complementary techniques to ensure robust findings.

Affinity purification coupled with mass spectrometry (AP-MS) represents a powerful approach for identifying TMEM18 interacting proteins. This technique would involve expressing tagged versions of TMEM18 (e.g., with FLAG, HA, or His tags) in X. tropicalis cells or tissues, followed by purification under conditions that preserve protein-protein interactions. Gentle detergents like digitonin or DDM (n-dodecyl β-D-maltoside) are often suitable for solubilizing membrane protein complexes while maintaining interactions. The purified complexes would then be analyzed by mass spectrometry to identify co-purified proteins.

Proximity labeling methods such as BioID or APEX2 offer advantages for studying membrane protein interactions in their native cellular context. These approaches involve fusing TMEM18 to a biotin ligase (BioID) or an engineered peroxidase (APEX2), which biotinylates nearby proteins when activated. After cell lysis, biotinylated proteins can be captured with streptavidin beads and identified by mass spectrometry. This methodology is particularly valuable for detecting transient or weak interactions that might be lost during conventional purification procedures.

Yeast two-hybrid (Y2H) screening, with modifications for membrane proteins such as split-ubiquitin or membrane yeast two-hybrid (MYTH) systems, can be employed to screen cDNA libraries derived from X. tropicalis tissues. These specialized Y2H variants are designed to accommodate membrane proteins like TMEM18 and can identify direct binary interactions.

Co-immunoprecipitation (Co-IP) experiments using antibodies against endogenous TMEM18 or epitope-tagged versions can validate interactions identified through high-throughput screens. These experiments can be performed under various physiological conditions to investigate how interactions might change in response to stimuli relevant to TMEM18's function in weight regulation.

Fluorescence techniques such as Förster resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) can visualize protein interactions in living cells. These approaches require expressing TMEM18 fused to one fluorescent protein fragment and potential interaction partners fused to complementary fragments. Interaction brings the fragments together, producing a fluorescent signal that can be detected and localized within cells.

What are the most effective methods for analyzing TMEM18 gene expression patterns in Xenopus tropicalis under different physiological conditions?

Analyzing TMEM18 expression patterns in Xenopus tropicalis under varying physiological conditions requires a methodical approach combining quantitative, spatial, and temporal assessment techniques. The most effective strategy would incorporate several complementary methods to provide a comprehensive understanding of expression dynamics.

Quantitative PCR (qPCR) offers a sensitive method for measuring relative changes in TMEM18 mRNA levels across different tissues or experimental conditions. For studying TMEM18's role in metabolism, researchers could analyze expression in response to feeding status (fed vs. fasted states), dietary composition (high-fat, high-carbohydrate, or balanced diets), or developmental stages . When designing qPCR experiments, careful selection of reference genes is essential; for X. tropicalis, genes like EF1α (elongation factor 1 alpha) or ODC (ornithine decarboxylase) are often suitable internal controls. The comparative Ct (ΔΔCt) method can be used to calculate fold changes in expression relative to control conditions.

RNA sequencing (RNA-seq) provides a broader transcriptomic context for TMEM18 expression analysis. This approach not only quantifies TMEM18 expression but also identifies co-regulated genes that might function in the same pathways. RNA-seq data can be analyzed for differential expression across conditions using software packages like DESeq2 or edgeR. Additionally, weighted gene co-expression network analysis (WGCNA) can identify modules of co-expressed genes that might reveal functional relationships.

In situ hybridization techniques allow visualization of TMEM18 mRNA spatial distribution within tissues. Both chromogenic and fluorescent in situ hybridization (FISH) can be employed, with the latter offering advantages for co-localization studies with other markers. For X. tropicalis brain tissue, where TMEM18 is likely expressed in regions like the hypothalamus, whole-mount in situ hybridization can be performed on embryos, while section in situ hybridization is more suitable for adult tissues.

Immunohistochemistry (IHC) using specific antibodies against TMEM18 enables protein-level expression analysis with cellular resolution. This technique has been successfully applied to other proteins in X. tropicalis brain tissue . Double or triple immunolabeling can identify cell types expressing TMEM18, such as neurons versus glial cells, providing insights into its functional context.

Reporter gene assays using TMEM18 promoter regions driving fluorescent protein expression in transgenic X. tropicalis can monitor transcriptional regulation dynamically. Techniques for generating transgenic X. tropicalis have been well-established and could be adapted to create TMEM18 reporter lines .

How can researchers design experiments to study the effects of TMEM18 polymorphisms on obesity risk using X. tropicalis?

Designing experiments to investigate the effects of TMEM18 polymorphisms on obesity risk using Xenopus tropicalis requires a multifaceted approach that leverages the genetic tractability of this model organism while addressing the complexity of obesity as a phenotype. A comprehensive experimental design would incorporate the following methodological components:

CRISPR/Cas9 gene editing can be employed to introduce specific human TMEM18 polymorphisms associated with obesity risk (such as rs939583 and rs1879523) into the corresponding regions of the X. tropicalis TMEM18 gene . This approach creates precise genetic models to study the functional effects of these variants. Alternatively, researchers could use homologous recombination to replace the endogenous X. tropicalis TMEM18 with human variants to create "humanized" gene models.

Phenotypic characterization of genetically modified X. tropicalis should include comprehensive metabolic assessment. This would encompass measurements of body weight, body composition (using techniques like CT scanning or MRI adapted for small animals), feeding behavior, energy expenditure, and glucose homeostasis. For accurate and standardized measurement of food intake in aquatic species like X. tropicalis, special feeding protocols need to be developed, potentially using labeled food sources to track consumption.

Dietary challenges can reveal genotype-specific responses to different nutritional environments. Researchers could expose X. tropicalis carrying different TMEM18 variants to diets varying in caloric density or macronutrient composition, similar to the approaches used in mouse models with 10% sucrose or 4.1% Intralipid supplementation . Phenotypic responses, including weight gain, adiposity, and metabolic parameters, would be monitored over time.

Molecular characterization should examine how TMEM18 variants affect gene expression and protein function. Transcriptomic analysis (RNA-seq) of relevant tissues such as brain and adipose tissue can identify differentially expressed genes between wild-type and variant carriers. Proteomic analysis can reveal changes in protein abundance or post-translational modifications. For membrane proteins like TMEM18, specialized techniques such as crosslinking mass spectrometry or hydrogen-deuterium exchange mass spectrometry can provide structural insights that might explain functional differences between variants.

Gene-environment interaction studies should investigate how TMEM18 variants interact with modifiable lifestyle factors. Similar to human studies showing interactions between TMEM18 rs939583 and factors like wine consumption, sugar-sweetened beverage intake, and physical activity , researchers could design experiments exposing X. tropicalis with different TMEM18 variants to varying activity levels or dietary components and measure differential responses.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.