Recombinant Xenopus tropicalis Transmembrane protein 196 (tmem196)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Xenopus tmem196

Recombinant Xenopus tropicalis Transmembrane Protein 196 (tmem196) is a synthetic protein engineered for research applications. It is derived from the tmem196 gene (UniProt ID: A4IIU3) and expressed in E. coli systems. This protein retains the full-length sequence (1–177 amino acids) and includes an N-terminal His-tag for purification and detection .

Comparative Analysis with Other Species

The table below contrasts recombinant tmem196 proteins across species, highlighting the Xenopus variant’s distinct features:

SpeciesExpression SystemTagPurityKey Applications
Xenopus tropicalisE. coliHis>90%SDS-PAGE, structural studies
Rattus norvegicusE. coliHis (Fc)-AviNot specifiedFunctional assays, antibody conjugation
Homo sapiensTobacco plantStrep>85%ELISA, Western blotting
Pongo abeliiCell-freeN/A>85%Biochemical assays

Data sourced from .

Mechanistic Studies

  • Tumor Suppression: While tmem196 is identified as a tumor suppressor in human lung cancer (via Wnt/β-catenin pathway inhibition) , its Xenopus ortholog may serve as a model to study conserved anti-tumorigenic mechanisms.

  • Membrane Signaling: The transmembrane topology suggests roles in cell adhesion, migration, or ion transport, warranting further investigation in developmental or disease models.

Experimental Considerations

  • Handling: Avoid repeated freeze-thaw cycles; store at -20°C/-80°C .

  • Detection: Anti-His antibodies or nickel-based probes can confirm protein integrity post-reconstitution .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them when placing your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please communicate your requirement. We will prioritize developing the specified tag whenever possible.
Synonyms
tmem196; Transmembrane protein 196
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem196
Target Protein Sequence
MCTSRQIIGSLLVLSVLEIGLGLSSVAVGAVTFFRVRMEQKPQLGDSSPVWSGACFLICG VCGIFCAKKKSGLIMILFSACCICGLIGGILNIQFLRALNKRSSSLYSLYLASMSLACIG ISGCTISTWLTCRLASYEQRRMFLEREHSLHHSHEMTEKDTENITNGGGPLALNGRV
Uniprot No.

Target Background

Database Links

KEGG: xtr:100125062

UniGene: Str.37635

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is recombinant TMEM196 protein typically expressed and purified?

Recombinant TMEM196 from Xenopus tropicalis is typically expressed in E. coli expression systems using an N-terminal His-tag for purification purposes . The expression construct contains the full-length sequence (amino acids 1-177) fused to the histidine tag, facilitating purification via affinity chromatography. The protein is usually supplied as a lyophilized powder after purification, with purity greater than 90% as determined by SDS-PAGE .

For researchers interested in protein expression, the protocol generally involves:

  • Transformation of expression plasmid into suitable E. coli strain

  • Culture growth and induction of protein expression

  • Cell lysis and initial clarification

  • Affinity purification using the His-tag

  • Quality assessment via SDS-PAGE

  • Lyophilization for long-term storage

What are the optimal storage and handling conditions for TMEM196?

For optimal stability and activity, recombinant TMEM196 protein should be stored according to these guidelines:

  • Long-term storage: -20°C to -80°C

  • Working aliquots: 4°C for up to one week

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose, pH 8.0

  • Avoiding degradation: Minimize freeze-thaw cycles by preparing single-use aliquots

For reconstitution, the following procedure is recommended:

  • Briefly centrifuge the vial to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (50% being standard)

  • Prepare aliquots for long-term storage at -20°C/-80°C

What expression systems are suitable for studying TMEM196 function?

While E. coli is commonly used for recombinant protein production , researchers studying TMEM196 function may benefit from expression systems that better recapitulate post-translational modifications and membrane insertion. Xenopus offers several advantages as an experimental system:

  • Transgenic approaches: Sperm-mediated transgenesis allows introduction of genes into Xenopus embryos before first cleavage, with homologous and heterologous promoters expressing accurately in F0 embryos and tadpoles .

  • Inducible expression systems: Two well-characterized binary inducible gene expression systems have been validated in Xenopus:

    • RU-486/mifepristone-inducible system

    • Tetracycline (Tet)-inducible system

These systems permit temporal control of gene expression, allowing researchers to express TMEM196 at specific developmental stages or in particular tissues when paired with appropriate promoters.

How can inducible gene expression systems be optimized for TMEM196 studies?

For temporal control of TMEM196 expression in Xenopus, two inducible systems have demonstrated effectiveness:

RU-486 Inducible System:

  • Components: CMV/GLVP plasmid and UAS-E1b promoter driving the gene of interest

  • Induction: Treatment with 500 ng RU-486 per g body weight

  • Response time: Rapid induction (within hours)

  • Induction magnitude: At least one order of magnitude above baseline

  • Germ-line transmissibility: Successfully transmitted to F1 progeny with consistent expression levels

Tetracycline (Tet) Inducible System:

  • Components: sCMV promoter driving rtTA2S-M2 and TetO elements upstream of gene of interest

  • Induction: Addition of 5 μg/ml doxycycline to rearing water

  • Response time: GFP detection within 4 hours, peak expression at 12 hours

  • Induction magnitude: Two to four orders of magnitude above baseline

  • Tissue specificity: Can be combined with tissue-specific promoters like neural-specific β-tubulin (NβT) or muscle-specific (pCar) promoters

The table below compares key parameters of these systems:

ParameterRU-486 SystemTet-Inducible System
InducerRU-486/mifepristoneDoxycycline
AdministrationInjection or waterAdded to rearing water
Response timeHours4-12 hours
Magnitude of induction>10-fold100-10,000-fold
Baseline expressionDetectableLow/undetectable
ReversibilityNot specifiedWithin 24-48 hours
Compatibility with tissue-specific promotersYesDemonstrated with neural and muscle promoters

What are the challenges in generating TMEM196 knockdown or knockout in Xenopus tropicalis?

Studying TMEM196 function through loss-of-function approaches presents several challenges:

  • Timing limitations of traditional methods:

    • mRNA injection into fertilized eggs and morpholino oligonucleotides have limited use for studying late developmental events like metamorphosis

    • Tadpoles become competent to respond to thyroid hormone only by the second week after fertilization

  • Solutions through inducible systems:

    • Using inducible systems to express dominant negative forms or gene editing components

    • The Tet-inducible system allows expression of transgenes at specific developmental windows

    • This approach permits determination of critical periods for gene function

For effective knockdown/knockout strategies, researchers could:

  • Use the Tet-inducible system to drive Cas9 expression for temporal control of gene editing

  • Express dominant negative forms of TMEM196 under inducible control

  • Utilize tissue-specific promoters for spatial restriction of knockdown effects

How can plasmids be optimized for TMEM196 expression studies in Xenopus?

Based on successful approaches with other genes in Xenopus, researchers can optimize plasmid design for TMEM196 studies following these guidelines:

For the Tet-inducible system:

  • Construct a plasmid containing rtTA2S-M2 under control of a suitable promoter:

    • For ubiquitous expression: simian cytomegalovirus (sCMV) promoter

    • For neural-specific expression: neural-specific β-tubulin (NβT) promoter

    • For muscle-specific expression: muscle-specific (pCar) promoter

  • Create a second plasmid containing:

    • TetO elements upstream of TMEM196

    • Optional fusion tags (e.g., GFP) for visualization

    • Appropriate poly(A) signal

The plasmids can be co-transformed into Xenopus embryos using the restriction enzyme-mediated integration method. This approach allows for:

  • Spatial control through tissue-specific promoters

  • Temporal control through doxycycline administration

  • Visualization through fusion tags

  • Heritable transmission to F1 progeny

What protocols are recommended for immunodetection of TMEM196?

For immunodetection of TMEM196 in Xenopus tissues, researchers can leverage the His-tag on recombinant proteins for initial validation studies . A recommended protocol would include:

  • Tissue preparation:

    • Fix tissues in 4% paraformaldehyde

    • Cryoprotect in sucrose and prepare sections (10-15 μm)

  • Immunohistochemistry protocol:

    • Block with 5% normal serum, 0.1% Triton X-100 in PBS

    • Incubate with anti-His antibody (1:500-1:1000) or specific anti-TMEM196 antibody

    • Apply fluorescently-labeled secondary antibody

    • Counterstain nuclei with DAPI

  • Western blot detection:

    • Prepare protein extracts in appropriate buffer

    • Separate proteins via SDS-PAGE

    • Transfer to PVDF or nitrocellulose membrane

    • Block and probe with anti-His or anti-TMEM196 antibodies

    • Visualize using chemiluminescence or fluorescent detection

For recombinant protein applications, SDS-PAGE has been validated as an effective method for TMEM196 detection .

How can TMEM196 function be studied during Xenopus metamorphosis?

Studying TMEM196 during metamorphosis presents unique challenges due to the timing of this developmental process. Researchers can employ these strategies:

  • Temporal control of expression:

    • The Tet-inducible system allows activation of transgenes at specific times in development

    • Treatment with doxycycline (5-50 μg/ml) can induce expression during specific developmental windows

    • Expression can be monitored using GFP fusion constructs

  • Stage-specific induction experiments:

    • Treat tadpoles with doxycycline at different Nieuwkoop and Faber (NF) stages

    • Compare phenotypes between early induction (e.g., stage 46-52) versus late induction (e.g., stage 56-58)

    • Document developmental outcomes through metamorphosis

  • Tissue-specific studies:

    • Use neural-specific (NβT) or muscle-specific (pCar) promoters to direct expression

    • Combine with inducible systems for temporal-spatial control

    • Assess tissue-specific effects during metamorphic transitions

The advantage of these approaches is that embryogenesis can proceed normally while the transgene remains silent, and expression can be induced precisely when needed for metamorphosis studies.

What comparative advantages does Xenopus tropicalis offer over Xenopus laevis for TMEM196 research?

While much of the transgenic methodology has been developed in Xenopus laevis , researchers studying TMEM196 may consider the relative advantages of Xenopus tropicalis:

FeatureXenopus tropicalisXenopus laevis
GenomeDiploidAllotetraploid
Generation time4-6 months1-2 years
Genome sequencingComplete reference genomeComplex due to tetraploidy
Gene editingMore straightforward due to diploidyComplicated by redundant genes
SizeSmaller (easier handling)Larger
Experimental historyEmerging modelExtensively studied
TMEM196 sequenceOriginal source of recombinant protein May have paralogs

How can protein-protein interaction studies be optimized for TMEM196?

For researchers investigating TMEM196 interaction partners, several approaches can be considered:

  • In vitro binding assays:

    • Leverage the His-tagged recombinant TMEM196 protein for pull-down assays

    • Use purified protein (>90% purity) for direct binding studies

    • Consider reconstitution in membrane-mimetic environments due to transmembrane nature

  • Cell-based assays in Xenopus:

    • Utilize the inducible expression systems to co-express TMEM196 with potential partners

    • Apply split-reporter systems (e.g., split-GFP) under Tet-inducible control

    • Express tagged versions for co-immunoprecipitation studies

  • In vivo studies:

    • Generate transgenic Xenopus expressing tagged TMEM196 under tissue-specific promoters

    • Use biotin proximity labeling techniques to identify neighbors in the membrane

    • Apply temporal control through the doxycycline-inducible system to study stage-specific interactions

For membrane proteins like TMEM196, special consideration should be given to maintaining the appropriate membrane environment during isolation and interaction studies.

What approaches are recommended for studying post-translational modifications of TMEM196?

To investigate post-translational modifications (PTMs) of TMEM196, researchers should consider:

  • Expression system selection:

    • While E. coli-expressed protein is valuable for structural studies, it lacks eukaryotic PTMs

    • Consider mammalian or insect cell expression for PTM studies

    • Xenopus oocyte expression may provide a more native modification pattern

  • Analytical techniques:

    • Mass spectrometry-based proteomics for comprehensive PTM mapping

    • Site-directed mutagenesis of potential modification sites

    • Phospho-specific or glyco-specific detection methods

  • In vivo approaches in Xenopus:

    • Express tagged versions of TMEM196 using the transgenic approaches

    • Isolate the protein from different developmental stages

    • Compare modification patterns across tissues and developmental timepoints

Given the transmembrane nature of TMEM196, particular attention should be paid to lipid modifications and glycosylation patterns that may affect membrane localization and function.

How should researchers interpret developmental phenotypes from TMEM196 manipulations?

When analyzing developmental phenotypes resulting from TMEM196 manipulation in Xenopus, researchers should consider:

  • Temporal windows of action:

    • The inducible systems allow determination of critical periods for gene function

    • Compare phenotypes from early induction versus late induction

    • Document the developmental stage at which phenotypes first appear

  • Tissue-specific effects:

    • Use tissue-specific promoters to distinguish primary from secondary effects

    • Compare neural-specific (NβT) versus muscle-specific (pCar) expression outcomes

    • Assess cell-autonomous versus non-cell-autonomous effects

  • Quantitative phenotype assessment:

    • Develop robust scoring systems for phenotype severity

    • Document phenotype penetrance and expressivity

    • Compare dose-dependent effects by varying inducer concentration (e.g., 5 μg/ml versus 50 μg/ml doxycycline)

Lessons from other transgenic studies suggest careful documentation of the relationship between inducer concentration, timing, and phenotypic outcomes is essential for mechanistic interpretation.

What controls are essential for TMEM196 functional studies in Xenopus?

Robust experimental design for TMEM196 studies should include these critical controls:

  • Expression system controls:

    • Uninduced transgenic animals to assess baseline/leaky expression

    • Wild-type siblings raised under identical conditions

    • Induced non-transgenic siblings to control for inducer effects

  • Construct controls:

    • GFP-only expression to distinguish tag effects from TMEM196 function

    • Mutated/inactive TMEM196 variants to confirm specificity

    • Alternative promoter constructs to verify tissue-specificity effects

  • Temporal controls:

    • Brief early induction (24 hours) followed by withdrawal

    • Late induction at different developmental stages

    • Continuous versus pulsed induction protocols

The search results demonstrate the importance of proper controls, showing that brief 24-hour induction of transgenes in early development had no effect on metamorphosis, while continuous or stage-specific induction produced clear phenotypes .

How might CRISPR-Cas9 technologies be integrated with TMEM196 research?

Future research combining CRISPR-Cas9 technologies with TMEM196 studies could involve:

  • Inducible genome editing:

    • Place Cas9 under Tet-inducible control for temporal regulation of editing

    • Express gRNAs targeting TMEM196 from tissue-specific promoters

    • Create conditional knockout models for developmental studies

  • Knock-in strategies:

    • Generate tagged versions of endogenous TMEM196

    • Introduce specific mutations to study structure-function relationships

    • Create reporter lines by inserting fluorescent proteins in-frame with TMEM196

  • CRISPRi/CRISPRa approaches:

    • Use dCas9 fusions for transcriptional repression or activation of TMEM196

    • Place these under inducible control for reversible manipulation

    • Combine with the validated Tet-inducible system for precise temporal control

These approaches would build upon the established transgenic technologies in Xenopus while leveraging cutting-edge genome editing capabilities.

What emerging technologies might advance TMEM196 structure-function analysis?

Several emerging technologies could significantly advance TMEM196 research:

  • Cryo-electron microscopy:

    • Determine high-resolution structures of purified TMEM196

    • Visualize protein in native membrane environments

    • Map interaction interfaces with binding partners

  • Single-cell transcriptomics in Xenopus:

    • Profile cells expressing TMEM196 across developmental stages

    • Identify co-expressed genes for functional context

    • Compare wild-type versus TMEM196-manipulated samples

  • Optogenetic control systems:

    • Develop light-inducible TMEM196 expression systems

    • Create photo-activatable TMEM196 variants

    • Combine with the existing chemical induction systems for multi-level control

These technologies would complement the established transgenic approaches in Xenopus and provide unprecedented insight into TMEM196 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.