Recombinant Xenopus tropicalis Transmembrane protein 205 (tmem205)

Shipped with Ice Packs
In Stock

Description

Introduction to Xenopus tropicalis Transmembrane Protein 205

Transmembrane protein 205 (tmem205) belongs to a family of integral membrane proteins found across various species, from zebrafish to humans. In Xenopus tropicalis, this protein plays several important cellular roles, particularly as a component of cellular membranes. The recombinant form of X. tropicalis tmem205 is produced through various expression systems to facilitate research applications and functional studies. The protein is commercially available in both full-length and partial forms, with varying expression hosts and purification methods .

Tmem205 in X. tropicalis shares structural and functional similarities with its orthologs in other species, including Xenopus laevis and human TMEM205. The conservation of this protein across evolutionary diverse species suggests its functional importance in fundamental cellular processes. The recombinant version enables researchers to study the protein's properties outside its native cellular environment, offering opportunities for structural analysis, functional characterization, and comparative studies.

Physical and Chemical Properties

Recombinant X. tropicalis tmem205 is typically produced as a purified protein with specific tags to facilitate detection and purification. The protein exhibits characteristic properties of transmembrane proteins, including hydrophobic regions that span cellular membranes. While the search results do not provide the specific amino acid sequence for X. tropicalis tmem205, we can infer its properties based on related proteins like the X. laevis ortholog.

For comparison, the X. laevis tmem205 consists of 188 amino acids with a specific sequence that includes multiple hydrophobic regions consistent with transmembrane domains . The protein is typically purified to a high degree (greater than 85-90% purity) as determined by SDS-PAGE analysis . This level of purity ensures reliable results in downstream applications and research studies.

Recombinant Production Platforms

Recombinant X. tropicalis tmem205 is produced using various expression systems, each offering specific advantages depending on the intended application. According to the search results, the protein is available as a product expressed in different hosts:

  1. Cell-free expression systems

  2. E. coli bacterial expression

  3. Yeast expression systems

  4. Baculovirus-infected insect cells

  5. Mammalian cell expression systems

Each expression platform influences the final properties of the recombinant protein, particularly regarding post-translational modifications, solubility, and functional activity. For instance, E. coli-based systems offer high yield but may lack complex post-translational modifications, while mammalian expression systems typically provide more native-like protein processing.

Purification and Quality Control

The purification of recombinant X. tropicalis tmem205 typically involves affinity chromatography, often facilitated by fusion tags such as histidine tags. The protein is purified to a standard of at least 85% purity as determined by SDS-PAGE analysis . This level of purification ensures that the recombinant protein is suitable for a wide range of research applications.

Quality control measures for commercially available recombinant tmem205 include:

  1. SDS-PAGE analysis to confirm protein size and purity

  2. Functional assays to verify activity where applicable

  3. Endotoxin testing for proteins intended for cellular applications

  4. Stability testing to determine optimal storage conditions

The protein is typically available in lyophilized form or in solution with appropriate buffer components to maintain stability during shipping and storage .

Cellular Roles of TMEM205

While the specific functions of X. tropicalis tmem205 are not extensively detailed in the search results, insights can be gained from studies of TMEM205 in other organisms. In human cells, TMEM205 has been implicated in resistance to the chemotherapeutic agent cisplatin . This suggests a potential role in cellular detoxification or drug transport mechanisms.

The evolutionary conservation of TMEM205 across species implies important fundamental cellular functions. As a transmembrane protein, it likely participates in:

  1. Membrane organization and stability

  2. Transport of specific molecules across cellular membranes

  3. Signaling pathways that rely on membrane-associated complexes

  4. Cellular responses to environmental stressors

Further research specific to X. tropicalis tmem205 would be needed to confirm these roles in amphibian cells.

Developmental Expression Patterns

Expression patterns of tmem205 during development could provide clues to its biological functions. While the search results do not provide specific expression data for X. tropicalis tmem205, information about protein expression in the related species X. laevis is mentioned . This could serve as a reference point for understanding potential developmental regulation of tmem205 in X. tropicalis.

Developmental expression data would be valuable for determining when and where the protein functions during embryogenesis and growth, potentially highlighting tissue-specific roles that may not be apparent from cellular studies alone.

Immunological Applications

Recombinant X. tropicalis tmem205 serves as an important tool for immunological research. It can be used as an antigen for antibody production, enabling the development of specific antibodies for detection of native tmem205 in tissue samples or cell cultures. The search results mention antibodies against tmem205 in various species, suggesting similar applications for X. tropicalis tmem205 .

These antibodies find applications in techniques such as:

  1. Western blotting for protein detection

  2. Immunohistochemistry for localization studies

  3. ELISA for quantitative analysis

  4. Immunoprecipitation for protein complex studies

Functional Studies and Drug Development

Given the potential role of TMEM205 in cisplatin resistance in human cancer cells, recombinant X. tropicalis tmem205 could be valuable for comparative studies investigating evolutionary conservation of this function . Such research might contribute to understanding mechanisms of drug resistance and potentially lead to the development of strategies to overcome chemotherapy resistance.

The availability of purified recombinant protein also facilitates:

  1. In vitro binding studies with potential interacting partners

  2. Structural analyses using techniques like X-ray crystallography

  3. Screening of small molecule libraries for compounds that modulate protein function

  4. Development of assays to measure protein activity

Evolutionary Conservation

TMEM205 shows notable conservation across species, indicating its biological importance. The search results mention TMEM205 in various organisms including humans, mice, zebrafish, and different Xenopus species . This conservation provides an opportunity for comparative studies to understand fundamental aspects of membrane protein evolution and function.

A comparative analysis of TMEM205 across species would involve:

  1. Sequence alignment to identify conserved domains

  2. Structural comparisons to determine evolutionary constraints

  3. Functional studies to assess conservation of biological activities

  4. Expression pattern analysis to evaluate developmental roles

Species-Specific Variations

While TMEM205 is conserved across species, there are likely species-specific variations that reflect adaptation to different physiological requirements. For X. tropicalis tmem205, these variations might relate to specific aspects of amphibian physiology, such as:

  1. Adaptation to aquatic environments

  2. Roles during metamorphosis

  3. Temperature sensitivity relevant to ectothermic organisms

  4. Tissue-specific functions unique to amphibians

Understanding these variations could provide insights into both the core functions of TMEM205 and its specialized roles in different organisms.

Knowledge Gaps

Despite the commercial availability of recombinant X. tropicalis tmem205, significant knowledge gaps remain regarding its specific functions and properties. The search results provide limited detailed information about this particular protein, suggesting opportunities for further research in areas such as:

  1. Detailed structural characterization

  2. Comprehensive functional analysis in amphibian cells

  3. Identification of interaction partners specific to X. tropicalis

  4. Examination of tissue-specific expression patterns throughout development

Future Research Opportunities

The study of recombinant X. tropicalis tmem205 offers several promising research directions:

  1. Comparative functional studies between amphibian and mammalian TMEM205

  2. Investigation of potential roles in amphibian-specific physiological processes

  3. Exploration of evolutionary adaptations in membrane protein structure

  4. Development of X. tropicalis as a model system for studying membrane protein function

Such research would not only advance our understanding of this specific protein but could also contribute more broadly to membrane protein biology and evolutionary developmental biology.

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes if necessary. We will fulfill requests whenever possible.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and arranged in advance. Additional charges will apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting to -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag will be determined during production. If you require a particular tag, please inform us, and we will prioritize its inclusion.
Synonyms
tmem205; TEgg066b10.1; Transmembrane protein 205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-188
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem205
Target Protein Sequence
MVAEGDPGNLVRTIHLLVLSASWGMQCWTTFVAGFVLIRGVPRHTFGLVQSKLFPFYNHI VLCCSFISLAIYAAYHPRELLSPSESVQITLFFVCLLAAALHARWFSPVTTKTMFKMHII EREHSLGQGVGLSANREAYQRLQEKDPKYKALRQRFMRYHGISSLCNLLCLLCNGANLVY MALLMPTL
Uniprot No.

Target Background

Database Links

KEGG: xtr:733568

STRING: 8364.ENSXETP00000017377

UniGene: Str.723

Protein Families
TMEM205 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What makes Xenopus tropicalis an advantageous model system for studying transmembrane proteins like tmem205?

Xenopus tropicalis offers several significant advantages for studying transmembrane proteins like tmem205. As a diploid organism with a highly conserved genome between frogs and humans, X. tropicalis facilitates more straightforward identification of orthologous genes compared to models with less conservation or duplicated genomes . Its high level of synteny makes genetic analysis more reliable and interpretable. Additionally, the Xenbase database (https://www.xenbase.org) provides user-friendly access to an accurate, annotated reference genome with excellent tools for genetic analysis .

For transmembrane protein research specifically, X. tropicalis offers advantages including:

  • High-throughput embryo production (4000+ embryos per mating)

  • Rapid development of organ systems

  • External development allowing easy observation and manipulation

  • Ability to absorb small molecules from culture medium, facilitating drug screening

  • Cost-effective maintenance compared to rodent models

These features make X. tropicalis particularly suitable for investigating the expression, localization, and function of transmembrane proteins during development and in disease models.

How is recombinant tmem205 typically expressed and purified from Xenopus tropicalis systems?

Recombinant tmem205 from Xenopus tropicalis can be expressed using several complementary approaches, each with distinct advantages depending on research objectives:

Expression systems:

  • In vitro transcription/translation using X. tropicalis egg extracts

  • Expression in Xenopus oocytes via microinjection of synthetic mRNA

  • Transgenic expression in X. tropicalis embryos

  • Cell-free protein synthesis systems

For purification of recombinant tmem205, which is a transmembrane protein, specialized approaches are necessary due to its hydrophobic domains. Typical methodologies include:

  • Detergent-based membrane solubilization using non-ionic detergents

  • Affinity chromatography using epitope tags (His, FLAG, or GST tags)

  • Size exclusion chromatography for final purification steps

When working with X. tropicalis for protein expression, researchers can take advantage of the organism's natural developmental processes by timing protein collection to coincide with stages of highest endogenous expression, potentially revealed through techniques such as in situ hybridization or immunohistochemistry .

What are the common phenotypic readouts when studying tmem205 function in Xenopus tropicalis?

When studying transmembrane proteins like tmem205 in Xenopus tropicalis, researchers can employ multiple phenotypic readouts that provide comprehensive insights into protein function:

Morphological analysis:

  • Histological staining of relevant organs at tadpole stage (approximately 6 days post-fertilization)

  • MicroCT, light sheet microscopy, and optical coherence tomography for detecting subtle morphological changes

  • Machine learning algorithms to detect differences between control and mutant samples

Functional assessments:

  • Quantitative behavioral assays including locomotion and working memory tests

  • Epilepsy assays using established video-imaging methods

  • Neuronal plasticity and action potential recordings in intact tadpoles

  • Primary cultures of neuronal cells or neuronal/muscle co-cultures derived from embryos with gene variants

These approaches can be supplemented with molecular analyses such as RNA-seq, proteomics, and phosphoproteomics to provide multi-dimensional characterization of tmem205 function across developmental stages and tissue contexts.

How can CRISPR/Cas9 genome editing be optimized for generating tmem205 knockout or knock-in models in Xenopus tropicalis?

Optimizing CRISPR/Cas9 genome editing for tmem205 manipulation in Xenopus tropicalis requires careful consideration of several technical aspects:

Guide RNA design and delivery:

  • Design multiple guide RNAs targeting conserved functional domains of tmem205

  • Ensure specificity by checking for potential off-target sites using Xenbase tools

  • For knockout models, target early exons to ensure complete loss of function

  • For knock-in models, design homology arms of at least 500-800bp for efficient homology-directed repair

Delivery methods:

  • Microinjection of Cas9 protein with guide RNAs into one-cell stage embryos

  • Alternative: injection of Cas9 mRNA with guide RNAs for more sustained expression

Validation strategies:

  • T7 endonuclease assay or high-resolution melt analysis for initial screening

  • PCR amplification and sequencing of the targeted region

  • Western blotting to confirm protein loss in knockout models

  • Phenotypic analysis using appropriate assays based on predicted tmem205 function

Optimizing mosaicism management:

  • Generate F0 mosaic embryos and raise to adulthood

  • Screen F0 adults for germline transmission of mutations

  • Establish stable F1 heterozygous lines

  • Intercross F1 heterozygotes to generate homozygous F2 mutants for analysis

This approach leverages X. tropicalis's advantages as a diploid organism, making genetic interpretation more straightforward compared to the pseudotetraploid X. laevis .

What strategies can be employed to study tmem205 protein-protein interactions in Xenopus tropicalis?

Investigating tmem205 protein-protein interactions in Xenopus tropicalis can be approached through multiple complementary strategies that leverage the unique advantages of this model system:

In vivo approaches:

  • Bimolecular Fluorescence Complementation (BiFC) in developing embryos

  • Förster Resonance Energy Transfer (FRET) using fluorescently tagged proteins

  • Proximity labeling techniques (BioID or APEX) adapted for Xenopus embryos

  • Co-immunoprecipitation from embryo or tadpole tissues followed by mass spectrometry

Ex vivo approaches:

  • Yeast two-hybrid screening using tmem205 as bait against Xenopus cDNA libraries

  • Pull-down assays using recombinant tmem205 and embryo/tadpole lysates

  • Surface Plasmon Resonance (SPR) for kinetic analysis of interactions

Validation strategies:

  • Genetic interaction studies using partial knockdowns of tmem205 and potential interactors

  • Rescue experiments using wild-type and mutant forms of tmem205

  • Domain mapping to identify specific interaction interfaces

These approaches can be particularly powerful in Xenopus due to the ability to perform tissue-specific analyses through targeted microinjection techniques, allowing the study of interaction dynamics in specific developmental contexts .

How can tmem205 function be compared between Xenopus tropicalis and human systems to understand evolutionary conservation?

Comparative analysis of tmem205 function between Xenopus tropicalis and human systems provides valuable evolutionary insights and can validate the relevance of findings for human health. This can be approached methodologically through:

Sequence and structural analysis:

  • Multiple sequence alignment to identify conserved domains and motifs

  • Comparative analysis of transmembrane topology predictions

  • 3D structure prediction and comparison between species

  • Analysis of syntenic regions to understand genomic context conservation

Functional complementation experiments:

  • Human tmem205 expression in Xenopus tmem205 mutants to assess functional rescue

  • Xenopus tmem205 expression in human cell lines with CRISPR-mediated tmem205 knockout

  • Comparison of subcellular localization patterns between species

Disease-relevant phenotypes:

  • Analysis of whether Xenopus tropicalis tmem205 mutations phenocopy human disease states

  • Comparison of tissue-specific expression patterns between species

  • Parallel analysis of protein interaction networks across species

Quantitative comparison table:

FeatureHuman tmem205X. tropicalis tmem205Functional Implication
Protein identityReference~70-80% (estimated)Core functions likely conserved
Expression patternTissue-specificDevelopmental stage-dependentContext-dependent regulation
Subcellular localizationCell membrane and organellesSimilar to human patternConserved trafficking mechanisms
Interaction partnersHuman-specific interactomeFrog-specific interactomeCore interactions conserved
Disease associationMay vary by populationCan be studied in mutantsModel validity for human disease

This type of comparative approach leverages X. tropicalis as a powerful model where phenotypes sometimes more closely recapitulate human conditions than mammalian models, as has been observed with other genes like pax6 and ush1c .

What are the optimal techniques for visualizing tmem205 localization in Xenopus tropicalis tissues?

Visualizing tmem205 localization in Xenopus tropicalis tissues requires specialized techniques optimized for transmembrane proteins. The following methodological approaches are recommended:

Antibody-based methods:

  • Immunohistochemistry on tissue sections using tmem205-specific antibodies

  • Whole-mount immunofluorescence for earlier developmental stages

  • Proximity ligation assay (PLA) for detecting protein-protein interactions in situ

Genetic tagging approaches:

  • Generation of fluorescent protein fusions (e.g., tmem205-GFP) through CRISPR knock-in strategies

  • mRNA injection of tagged constructs for transient expression studies

  • Creation of stable transgenic lines expressing fluorescently tagged tmem205 under endogenous regulatory elements

Advanced imaging techniques:

  • Confocal microscopy for high-resolution subcellular localization

  • Light sheet microscopy for whole-embryo visualization with minimal photodamage

  • Super-resolution microscopy (STED, PALM, STORM) for nanoscale localization

  • Live imaging in transparent tadpoles for dynamic studies

Optimization considerations:

  • Fixation conditions must be carefully optimized for transmembrane proteins

  • Permeabilization protocols require balancing between membrane accessibility and epitope preservation

  • For antibody-based detection, validation using knockout controls is essential

  • For fluorescent protein fusions, verification that tagging does not disrupt protein function

These techniques can be combined with tissue-specific markers to provide context for tmem205 localization within developing organs and systems in X. tropicalis .

What are the key considerations when designing morpholino knockdown experiments targeting tmem205 in Xenopus tropicalis?

Designing effective morpholino knockdown experiments for tmem205 in Xenopus tropicalis requires careful attention to several methodological considerations:

Morpholino design strategies:

  • Translation-blocking morpholinos: Target the 5' UTR or translation start site region of tmem205 mRNA

  • Splice-blocking morpholinos: Target exon-intron boundaries to disrupt proper splicing

  • Design at least two different morpholinos with non-overlapping target sequences to control for off-target effects

Controls and validation:

  • Include standard control morpholino at equivalent concentrations

  • Perform rescue experiments using morpholino-resistant tmem205 mRNA

  • Validate knockdown efficiency through Western blotting or qPCR

  • Consider using CRISPR knockout as complementary validation

Dosage optimization:

  • Perform dose-response studies (typically 1-20 ng per embryo)

  • Monitor for non-specific toxicity at higher doses

  • Establish a dose that provides consistent phenotype with minimal off-target effects

Delivery considerations:

  • Inject at 1-2 cell stage for global knockdown

  • For tissue-specific effects, target specific blastomeres at 4-8 cell stage

  • Consider using photo-activatable morpholinos for temporal control

Phenotypic analysis:

  • Begin with morphological assessment at key developmental stages

  • Employ molecular markers to assess impact on specific developmental pathways

  • Use functional assays appropriate to the predicted function of tmem205

While morpholinos provide rapid knockdown capability, researchers should be aware of their limitations including potential off-target effects and limited duration of action. Complementary approaches such as CRISPR-mediated mutagenesis should be considered for definitive functional studies .

How can gynogenetic screening be utilized to identify genetic interactions with tmem205 in Xenopus tropicalis?

Gynogenetic screening represents a powerful and efficient approach for identifying genetic interactions with tmem205 in Xenopus tropicalis, significantly accelerating genetic analysis compared to traditional crossing methods:

Methodological approach:

  • Generate haploid embryos by fertilizing eggs from heterozygous tmem205 mutant females with UV-irradiated sperm (which activates development but contributes no genetic material)

  • Diploidize the embryos using cold shock protocol to prevent second polar body release

  • Screen resulting gynogenetic diploid embryos for phenotypes of interest

  • Analyze segregation patterns to identify potential genetic interactions

Advantages for tmem205 interaction studies:

  • Rapid identification of recessive genetic interactions without time-consuming crosses

  • Reduced animal housing requirements compared to traditional genetic screens

  • Ability to quickly map interactions relative to centromeres based on frequency of phenotype appearance

  • Can identify chromosome location of interacting mutations efficiently

Analytical framework:
The frequency of recessive mutation appearance in gynogenetic embryos depends on the distance from the centromere, providing initial mapping information. This can be combined with SSLP-based genetic mapping for more precise localization of interacting loci .

Practical workflow:

  • Generate tmem205+/- carrier females through CRISPR mutagenesis

  • Subject these carriers to chemical mutagenesis to generate potential interacting mutations

  • Perform gynogenetic screening on F1 offspring

  • Identify embryos showing enhanced or suppressed tmem205-associated phenotypes

  • Confirm interactions through traditional crossing and molecular analysis

This approach can reveal genes functioning in the same developmental or cellular pathways as tmem205, providing valuable insights into its biological function and relevance to human disease .

How can Xenopus tropicalis tmem205 models contribute to understanding human disease mechanisms?

Xenopus tropicalis tmem205 models can provide valuable insights into human disease mechanisms through several methodological approaches that leverage the unique advantages of this model system:

Disease mechanism investigation:

  • Generate precise tmem205 mutations that mimic human disease variants using CRISPR/Cas9

  • Compare phenotypes between Xenopus models and human patient presentations

  • Identify conserved molecular pathways affected by tmem205 dysfunction

  • Screen for genetic modifiers that enhance or suppress disease phenotypes

Therapeutic development pipeline:

  • Leverage Xenopus embryos' ability to absorb small molecules from culture medium

  • Perform high-throughput drug screening on tmem205 mutant embryos

  • Test candidate compounds for rescue of disease-associated phenotypes

  • Validate hits in human cell-based systems

Comparative disease modeling advantages:
Xenopus tropicalis disease models sometimes more accurately recapitulate human conditions than rodent models. For example, mutations in pax6 and ush1c genes in Xenopus produce phenotypes more similar to human patients than corresponding mouse models . This suggests tmem205 models may similarly provide unique insights not available in mammalian systems.

Quantitative phenotyping approaches:

  • Advanced imaging techniques combined with machine learning algorithms

  • Quantitative behavioral assays for neurodevelopmental phenotypes

  • Electrophysiological recordings for functional assessments

  • Molecular profiling of affected tissues

These approaches can establish causal relationships between tmem205 variants and disease mechanisms, potentially revealing novel therapeutic targets or approaches for related human conditions.

What considerations are important when designing rescue experiments to validate tmem205 function in Xenopus tropicalis?

Designing robust rescue experiments to validate tmem205 function in Xenopus tropicalis requires careful methodological planning to ensure interpretable results:

Experimental design considerations:

  • Construct design:

    • Generate rescue constructs containing wild-type tmem205 coding sequence

    • Include epitope tags that allow distinction from endogenous protein

    • Create domain-specific mutants to map functional regions

    • Consider using species-specific variants (human vs. Xenopus) to test conservation

  • Expression control:

    • Use endogenous promoter elements when possible for physiological expression

    • Alternative: use tissue-specific or inducible promoters for targeted rescue

    • Calibrate expression levels to avoid overexpression artifacts

    • Consider temporal control using heat-shock or hormone-inducible systems

  • Delivery methods:

    • mRNA injection for early, transient rescue

    • DNA constructs for longer-term expression

    • Transgenic approaches for stable, heritable rescue

    • Tissue-targeted injections for region-specific rescue

  • Controls and validation:

    • Include negative controls (inactive mutant versions)

    • Perform parallel rescue with human tmem205 to test functional conservation

    • Validate protein expression through Western blotting or immunostaining

    • Quantify rescue efficiency using appropriate phenotypic metrics

Rescue assessment framework:

Phenotypic ParameterQuantification MethodExpected Outcome in Successful Rescue
Morphological defectsImaging and morphometricsReturn to wild-type measurements
Molecular markersIn situ hybridization, qPCRRestoration of normal expression patterns
Protein localizationImmunostaining, live imagingProper subcellular distribution
Functional readoutsBehavioral/physiological assaysRecovery of normal function
Survival ratesKaplan-Meier analysisImproved survival compared to untreated mutants

These approaches leverage the experimental advantages of X. tropicalis, including the ability to perform tissue-specific analyses and create chimeric embryos to dissect tissue-autonomous versus non-autonomous requirements for tmem205 function .

How can transcriptomic analysis be optimized to understand the downstream effects of tmem205 manipulation in Xenopus tropicalis?

Optimizing transcriptomic analysis to understand downstream effects of tmem205 manipulation in Xenopus tropicalis requires careful experimental design and analytical approaches:

Experimental design considerations:

  • Sample preparation strategies:

    • Compare multiple tmem205 perturbation approaches (CRISPR knockout, morpholino knockdown, overexpression)

    • Include appropriate controls for each manipulation method

    • Collect samples at multiple developmental timepoints to capture dynamic effects

    • Consider tissue-specific isolation for targeted analysis

  • RNA-seq optimization:

    • Deep sequencing (>30 million reads per sample) to capture low-abundance transcripts

    • Paired-end sequencing for improved transcript assembly and isoform detection

    • Strand-specific libraries to distinguish sense/antisense transcription

    • Include spike-in controls for normalization and technical validation

  • Advanced transcriptomic approaches:

    • Single-cell RNA-seq to capture cellular heterogeneity in response to tmem205 manipulation

    • Spatial transcriptomics to preserve tissue context information

    • Long-read sequencing for improved isoform resolution

    • Ribosome profiling to assess translational impacts

Analytical framework:

  • Differential expression analysis:

    • Compare expression profiles between tmem205-manipulated and control samples

    • Identify significantly altered genes using appropriate statistical methods

    • Perform clustering analysis to identify co-regulated gene modules

    • Validate key findings using qPCR or in situ hybridization

  • Pathway and network analysis:

    • Gene Ontology (GO) enrichment analysis

    • Pathway enrichment using KEGG, Reactome, or other databases

    • Protein-protein interaction network analysis to identify affected hubs

    • Transcription factor binding site analysis to identify regulatory mechanisms

  • Comparative analysis:

    • Cross-reference findings with human disease-associated transcriptomic signatures

    • Compare with other model systems to identify conserved responses

    • Integrate with proteomics data when available for multi-omics perspective

This comprehensive approach leverages the experimental advantages of X. tropicalis including its diploid genome, which simplifies transcriptomic analysis compared to the pseudotetraploid X. laevis , while providing insights into the molecular pathways affected by tmem205 manipulation that may be relevant to human disease mechanisms.

What are the current limitations and future directions in Xenopus tropicalis tmem205 research?

Current research on tmem205 in Xenopus tropicalis faces several methodological and conceptual limitations, but also presents exciting future directions:

Current limitations:

  • Technical challenges:

    • Limited availability of tmem205-specific antibodies validated for Xenopus

    • Challenges in studying post-metamorphic stages due to historical focus on early development

    • Difficulty in generating aged models due to extended lifespan (>15 years)

    • Potential differences in genetic background affecting penetrance and expressivity

  • Knowledge gaps:

    • Incomplete understanding of species-specific differences in tmem205 function

    • Limited longitudinal studies comparing disease progression to human conditions

    • Need for more sophisticated behavioral and physiological assays for phenotyping

    • Challenges in distinguishing between direct and indirect effects of tmem205 manipulation

Future directions:

  • Methodological advances:

    • Application of new genome editing technologies beyond CRISPR for more precise manipulation

    • Development of conditional/inducible systems for temporal control of tmem205 expression

    • Integration of emerging imaging technologies for dynamic tracking of tmem205 in vivo

    • Implementation of machine learning approaches for automated phenotyping

  • Research opportunities:

    • Comprehensive characterization of tmem205 function across developmental stages

    • Investigation of tissue-specific roles through conditional knockout approaches

    • Cross-species comparative analysis to define evolutionarily conserved functions

    • Integration with human genetic data to validate disease relevance

  • Translational potential:

    • High-throughput screening for compounds modulating tmem205 function

    • Development of tmem205-based biomarkers for disease diagnosis or progression

    • Preclinical testing of gene therapy approaches targeting tmem205-related disorders

    • Exploitation of the Xenopus system for target validation in drug discovery pipelines

These future directions will benefit from the ongoing refinement of X. tropicalis as a genetic model system, including improvements in genomic resources, phenotyping methods, and experimental techniques that continue to enhance its utility for studying human disease genes .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.