Recombinant Xenopus tropicalis Transmembrane protein 211 (tmem211)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly indicate them in your order notes, and we will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery information, please consult your local distributor.
Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
tmem211; Transmembrane protein 211
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Xenopus tropicalis (Western clawed frog) (Silurana tropicalis)
Target Names
tmem211
Target Protein Sequence
MMVSCMGSLWVILSLILTLISGFSLMSSAWYKTDTISFGVFVHCIGPKNMPCNQTCIYYR TLEEIPDIFGKIAAVLLFGGWLLLSFGAVLVLSWTIIPVGLCQRRVCTPARYAQISAVVV TVLGLLVFPFNLHSEFARQICGSSFIYKSGDCCLGWGYMMAIVTVMLSCFLPFIGRYNLN EIKTKILLSKM
Uniprot No.

Target Background

Database Links
Protein Families
TMEM211 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • Why is Xenopus tropicalis preferred over Xenopus laevis for recombinant tmem211 studies?

    Xenopus tropicalis offers several advantages over X. laevis for recombinant protein studies:

    • True diploid genome (unlike the allotetraploid X. laevis), simplifying genetic manipulation and analysis

    • Higher conservation of gene synteny with the human genome, enhancing translational relevance

    • Shorter generation time, facilitating multigenerational experiments and transgenic line creation

    • Simpler genome that was sequenced before X. laevis, providing more robust genomic resources

    • More amenable to targeted mutagenesis approaches using modern gene editing technologies

    These advantages make X. tropicalis particularly valuable for studying transmembrane proteins like tmem211 where genetic manipulation and cross-species comparisons are crucial.

  • What expression systems are optimal for producing recombinant Xenopus tropicalis tmem211?

    For recombinant expression of X. tropicalis tmem211, E. coli-based systems have been successfully employed with specific considerations for membrane proteins . The methodology includes:

    • Using expression vectors containing N-terminal 10xHis tags to facilitate purification

    • Optimizing codon usage for bacterial expression

    • Culturing in Tris/PBS-based buffer systems (pH 8.0)

    • Supplementing with 6% trehalose as a stabilizing agent

    • Implementing either liquid formulation or lyophilization for stable storage

    Alternative expression systems like insect cells or mammalian cells may provide better post-translational modifications but require different optimization parameters.

  • How should recombinant tmem211 be stored and handled to maintain activity?

    Optimal handling of recombinant tmem211 requires:

    • Storage at -20°C/-80°C upon receipt

    • Aliquoting for multiple use to avoid repeated freeze-thaw cycles

    • For lyophilized protein: 12-month shelf life at -20°C/-80°C

    • For liquid formulation: 6-month shelf life at -20°C/-80°C

    • Working aliquots can be stored at 4°C for up to one week

    Stability can be improved by adding glycerol (10-15%) to prevent freeze-damage to the transmembrane regions during storage.

  • What are common applications for recombinant X. tropicalis tmem211 in basic research?

    Basic research applications include:

    • Antibody production and validation

    • Protein-protein interaction studies

    • Structural analysis of transmembrane domains

    • Comparative studies with human TMEM211 homologs

    • Development of functional assays for membrane transport or signaling

    These applications provide foundation knowledge before proceeding to more complex in vivo studies.

Advanced Research Questions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.